KEGG   Mus musculus (mouse): 66928
Entry
66928             CDS       T01002                                 

Symbol
Dmac1, 1700027K24Rik, 3110001D03Rik, Tmem261
Name
(RefSeq) distal membrane arm assembly complex 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4536
Other DBs
NCBI-GeneID: 66928
NCBI-ProteinID: NP_080125
MGI: 1914178
Ensembl: ENSMUSG00000028398
Vega: OTTMUSG00000000360
UniProt: Q9CQ00
Position
4; 4 C3
AA seq 111 aa
MGSSFSGSTEFSAPAPPTVSTAVPANPPAKSAVPASPARDPELKTCWSCRVLSGSTLFGA
GTYVYLVARRPLKQGIPPGPGTVLQMVIGISIACWGVVVLVDPKGKSHPVI
NT seq 336 nt   +upstreamnt  +downstreamnt
atggggtcctctttttcggggagtaccgagttttccgctcctgcccccccaactgtttcc
acagcggttcccgcgaacccacccgcgaaatccgccgtgccggcctcccccgcccgggac
cctgagttaaaaacctgctggagttgtcgcgtgctgtcgggctctacactcttcggggcg
ggcacctacgtctatttggtggccaggcggcccctgaagcaaggaatcccacctggccca
ggcaccgttctgcagatggtcatcggcatcagtattgcctgttggggtgtagttgttctg
gtagaccccaaagggaagagccacccagttatttga

DBGET integrated database retrieval system