KEGG   Mus musculus (house mouse): 66931
Entry
66931             CDS       T01002                                 
Symbol
1700010I14Rik
Name
(RefSeq) RIKEN cDNA 1700010I14 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TSNAXIP1_N
Other DBs
NCBI-GeneID: 66931
NCBI-ProteinID: NP_001334473
MGI: 1914181
Ensembl: ENSMUSG00000023873
UniProt: Q7TPG0 Q3TTN6 Q9DAH6
Position
17:9207152..9227151
AA seq 532 aa
MAEDQEPDFYLKWKHCEKPGVKTLSNLRKLLSQLQEDHRKDISVYISGHLNPRKLYKPPE
TIFQHWRNSNRTWEKPTHSTPTIPPASRNKEVSEMKDAWVHFTVSTALHPDDTHNTPLFR
YLNPRVQASRALKDGASAALQEEEKELKERLAFSREKHMKEELRLPEMKVLRYPEVVSSR
QCSRSAPGRDVYRYISPYLAGITKADSYKKFLSFQREVLAKEETLKYDFTGSKVAVAHEN
RLKEELQKICTCNPQQFNRLQVFGEIFEDICNSSLIFGDLLKEIKDEYELYMAALLDSQP
TAQYQRLLAEVRGLENSPRPSCDIDQAKEHLRKVQQAYLEALEHNDKLRNELEAESLLLQ
SAKEKAANGKMKDEKELTLVEKVEKRRCEIFEKLDEIKALEKHIKENMVHSGVFKIAESG
LKSIEDEAIKLETSNRILKKKIKVIESQMKQLLLRSKISEEERQRTSGSAMEMLLLIICP
TGASVWNVLHPRLVDRCVLQVTPSTLYVYTYTLYAVHLLFCNFELDKTGLNI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctgaggatcaggaacctgacttttacctaaagtggaagcactgtgagaaaccgggt
gttaagactctaagcaacttaaggaaactcctgtcccaactccaggaggaccacaggaag
gacatcagtgtgtacatttcaggacacctgaaccccaggaagctctacaagccacctgag
accattttccagcactggcgcaattccaacaggacatgggagaaacccacccactccaca
cccaccatccccccggcctccagaaacaaagaagtatcagagatgaaggacgcttgggtt
cactttacagtgagcacagccctgcatcccgatgacacacacaacacgccactgttcagg
tacctgaacccacgcgtacaggcctcccgtgctctcaaagatggtgcctccgcggctctg
caggaggaggagaaggaactgaaggaaagacttgcattttctcgggaaaaacacatgaag
gaagaactcaggctgcctgagatgaaagtgctcagatacccagaggtggtatccagccgc
cagtgctccaggtctgccccaggcagggatgtgtaccgttacatcagcccctacctagct
ggtataacgaaagccgacagctacaagaagttcctgagtttccaaagagaagtgctggca
aaggaagaaaccctgaagtatgacttcacggggagcaaggtggctgtggcccatgagaac
agactgaaggaggagctccagaagatatgcacctgcaaccctcagcagttcaacaggttg
caggtctttggggaaatctttgaggatatttgcaacagctctttgatctttggggatcta
ctgaaagagattaaggatgaatatgaactctacatggcagctctcctggactcacagccc
acagcgcagtatcagcggctcttggctgaagtcagggggttggagaacagccccaggccc
agctgtgacattgaccaagccaaggagcacctgaggaaggtccagcaggcttatctagaa
gccttggagcacaacgacaaactcaggaatgagctggaggctgagagcttattgctgcag
tctgctaaggaaaaagcagctaatgggaaaatgaaggatgagaaggaactgactctggtc
gaaaaggtggagaagaggaggtgtgaaatctttgagaaattggatgagattaaagcgctt
gagaaacacatcaaagaaaacatggtgcactcgggagtatttaagatcgcagagagtggc
cttaaaagcatagaggatgaagccataaagttggaaacatcaaacagaatcttaaagaag
aaaataaaagtgattgaaagccagatgaagcagctcttactaaggagtaagatcagcgag
gaggaaaggcaacgaacatctggatcggcgatggagatgctgcttcttatcatctgtccc
actggagcgtcagtgtggaacgtgctccatcctcggcttgttgatcgatgtgtcctccag
gtgactccttccactttatatgtgtatacatatactttatatgcagttcatcttttattc
tgtaactttgaactggacaaaacaggtttaaatatttaa

DBGET integrated database retrieval system