KEGG   Mus musculus (mouse): 66934
Entry
66934             CDS       T01002                                 

Gene name
Dsn1, 1700022L09Rik, AW552447
Definition
(RefSeq) DSN1 homolog, MIS12 kinetochore complex component
  KO
K11544  kinetochore-associated protein DSN1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66934 (Dsn1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      66934 (Dsn1)
SSDB
Motif
Pfam: MIS13
Other DBs
NCBI-GeneID: 66934
NCBI-ProteinID: NP_080129
MGI: 1914184
Ensembl: ENSMUSG00000027635
Vega: OTTMUSG00000016163
UniProt: Q9CYC5
Position
2; 2 H1
AA seq 348 aa
MTSVTRSEDQEPTMSETQDRPLQPSLKPLEALPQSSAYQEMMTQGVSEEKNHLGSNPGEG
ESCGADHQEGSQLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNRRKSLAPFHPGITELCR
SISVKLAQSQRLGALLLSSFQFSVEKLEPFLKNTKDFSLECFRAKASSLSEELKHFTDRL
GNDGTLQKCFVEDSKEKAADFSLEASVAEVKEYITKFSLERQAWDRLLLQYQNEVPPEEM
PRGSTETRITEVKVDPAAYLRSSQKEVLSTKPDYQRIVQDQNQVFAYVELVMDELQGSVK
QLQALMDESTQYLQKVSVQLKKRSMDQLDSSPARKLLKLPLQSSPSTQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgacgtcagtgaccagatcagaagaccaggaacccacgatgtccgagactcaggatcgt
ccattgcagccaagtctcaagcctttggaagcattgcctcaatcctctgcctaccaggaa
atgatgacgcaaggcgtttcagaggaaaaaaaccaccttggctcgaaccctggagagggg
gaaagttgtggtgccgaccaccaggagggatctcagttgaggtcctttcatttgtcccct
caagaacagtctatccgtcctcaagacagaaggcagtcctggagacgagcaagcatgaaa
gaagtaaaccggcggaagtcattggctcccttccacccaggcatcacagagctctgcagg
tccatcagtgtgaagttagcccagagccaacggctgggcgccctcctgctctccagcttc
cagttctctgttgaaaaacttgaacctttcttaaagaacactaaggacttcagccttgaa
tgttttagagcgaaagcatcttctctctctgaagaattgaaacattttacagacaggctg
ggaaatgatggaacactgcaaaaatgttttgttgaagattcaaaagaaaaagcagcagat
ttttcactggaagcatcagtagctgaggtgaaagaatatataacaaagttttctttagag
cgtcaggcctgggatcggctcttactgcagtaccagaacgaggttccacctgaagagatg
cccagaggatcaactgaaaccagaatcactgaagtcaaggtggatcctgcagcctacctc
aggtcttcccagaaggaagttcttagcacgaagccagactaccagagaatagtacaagat
cagaaccaagtctttgcctacgtggagttagtgatggatgagctccaaggatcagtgaag
cagctgcaagccctcatggatgagagtactcagtacctccagaaggtgtcagtacagctc
aagaagagaagtatggaccaattagactcttcacctgctcggaaactgctcaagctcccc
ctccagagctcaccttccacgcagtga

DBGET integrated database retrieval system