KEGG   Mus musculus (mouse): 66935Help
Entry
66935             CDS       T01002                                 

Gene name
Cir1, 1700023B02Rik, 2810021A19Rik, Cicr, Cir
Definition
(RefSeq) corepressor interacting with RBPJ, 1
  KO
K06066  CBF1 interacting corepressor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    66935 (Cir1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    66935 (Cir1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cir_N
Motif
Other DBs
NCBI-GeneID: 66935
NCBI-ProteinID: NP_080130
MGI: 1914185
Ensembl: ENSMUSG00000041777
Vega: OTTMUSG00000013426
UniProt: Q9DA19
Position
2; 2 C3
AA seq 450 aa AA seqDB search
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQDYVASDCEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKS
DKKKKKLQKSKNKHKKRKNKSPSSSSSSSSSSSSSSSSSSSSSSSSETSDSSSESDNKEK
KREKEKRKKKKKTKCSESKSSDCKEDKPKNMLYEELSSSHSDRGKAQEKLRFPKQESSGE
NSMWVHSASDRTSRSHRHSPEKKGSDRNRGIRSRSRSRAESSRRSRSRSPYRQKHREVRS
RPHRSPSEEQKGRKGTRSHGEGDHRREHVR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtcattcgccaatttcatgtgtaagaaggacttccatcctgcgtccaaatcc
aacatcaagaaggtatggatggcagaacagaaaatatcgtatgataaaaagaaacaagaa
gaattaatgcaacagtaccttaaagagcaggagtcgtatgataacagattgcttatggga
gatgaacgtgtgaagaatggcctgaatttcatgtacgaggccccaccaggagttaagaaa
gaaaacaaagagaaagaagaaacggaaggagagaccgagtacaagtttgaatggcagaaa
ggcgctccgagagaaaaatatgccaaagatgacatgaacatcagagatcagccctttggt
attcaggttcgaaatgtaaggtgtattaaatgtcacaagtggggccatgtgaacacagat
cgagagtgtcccttgtttggtctttctgggatcaatgcaagttcagttcctactgatggc
tcagggccgtcgatgcacccctcggagctaatagcggagatgagaaacagtgggtttgca
ctgaaacgaaatgtactggggagaaacttgaccgcaaatgatccatcacaggactatgtc
gcaagtgactgtgaagaagaccctgaagttgagttcttaaagtcgctcaccaccaagcag
aagcagaagctcctcaggaaattggatagacttgaaaagaaaaaaaagaaaaagaaaagt
gataagaaaaagaagaagttacagaagagcaaaaataaacacaagaaacgtaaaaacaaa
tccccttcctcttcctcctcttcctcctcttcctcctcttcctcctcctcctcctcctct
tcctcttcctcctcctcggagacatcagatagcagcagtgagagtgataacaaagaaaag
aaaagagagaaagagaagaggaagaagaagaagaaaaccaaatgttctgaaagtaaatcc
agtgactgtaaggaggacaagcctaagaacatgctttacgaagaactttccagcagtcac
agtgacaggggaaaagcccaggaaaaattaaggtttccaaaacaagagagttctggggag
aatagcatgtgggtccattctgcttctgaccggacatccagaagccaccggcacagtcca
gagaagaaagggtctgacagaaatcggggaatccgaagtcggagccgtagccgggctgag
agcagccggcgaagcagaagcaggagtccttaccgtcagaagcacagggaggtgaggagc
cggccacaccggagccctagtgaagagcagaagggaagaaagggcaccagaagccatggt
gaaggtgaccatagaagagagcacgtgcgctga

DBGET integrated database retrieval system