KEGG   Mus musculus (mouse): 66942Help
Entry
66942             CDS       T01002                                 

Gene name
Ddx18, 2310005B10Rik
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    66942 (Ddx18)
   03009 Ribosome biogenesis [BR:mmu03009]
    66942 (Ddx18)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     66942 (Ddx18)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    66942 (Ddx18)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Helicases
    66942 (Ddx18)
  Pre-60S particles
    66942 (Ddx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 66942
NCBI-ProteinID: NP_080136
MGI: 1914192
Ensembl: ENSMUSG00000001674
Vega: OTTMUSG00000019928
UniProt: Q8K363 B2RUM8
Position
1; 1 E2.3
AA seq 660 aa AA seqDB search
MSQLQMKLLRRKIEKRNAKLRQRNLKLQETSDTSLSQPQNGDVPKETGKGGKVKKALKRS
VPVDSAEAQSGGMPEETLENGKVKKSPQKLTTLANGEAAPTPPPDSEVKKKKKKKRKMAN
DAGPDTKKAKTEESAEACEEPEDDVKKADDSEVPSLPLGLTGAFEDTSFASLSNLVNENT
LKAIEEMGFKRMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPVIELIVKLKFMPRN
GTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEVQKLLNGINIIVATPG
RLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPARRQTMLFSATQTRK
VEDLARISLKKEPLYVGVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKVMV
FFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARGLD
IPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLNQ
FDFSWSKVSDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVA
LSFGFKVPPFVDLNVSSHDGKLKKRGGGGGFGYQKTKKVEKSKIFKHISKKPADRRQFSH
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagttacagatgaaactcctgcgcaggaagatcgagaagcggaatgccaagctg
cggcagcgaaacctgaagctgcaagaaacatcagacacaagcctgtcccaacctcaaaat
ggagatgtgcctaaagaaacaggaaaaggtggaaaagtgaaaaaggccctgaaacgttct
gtgcctgtggactcagcagaagcacaaagtggaggcatgcctgaggagaccttggaaaat
ggcaaagttaaaaagtcaccccagaaactcacaactttagccaacggagaagcagcacca
acaccacctcctgattcagaagtaaaaaagaaaaagaagaaaaagaggaaaatggcaaat
gatgccgggcctgatacaaaaaaagcgaaaactgaagaaagtgctgaggcttgtgaggaa
ccagaagatgatgtgaaaaaggcagatgacagcgaggtgcccagcctgcccctaggactg
acaggtgcttttgaggacacttcatttgcttccttgtctaatctcgtcaatgagaacacc
ctgaaggccatagaagaaatgggcttcaagcgcatgacggagatccagcataaaagtatc
aggccacttctggaaggcagggaccttctggcggctgcgaaaaccggcagtggcaaaacc
ctcgctttcctcatccctgtgatcgagctcattgtcaagttgaagttcatgcccaggaat
ggaacaggagtcctgattctctctcctaccagagaactggccatgcagacctttggtgtt
ctcaaggagctgatgacgcaccacgttcacacgtatgggctgatcatgggcggcagcaac
aggtctgctgaagtgcagaagctcctcaatgggatcaacatcatcgtggccacgcccggc
cggctcctggaccacatgcagaacacgccagggtttatgtacaagaacctgcagtgtctg
gttattgatgaggctgaccgtatcttggatgttgggtttgaagaagaattaaagcaaatt
attaaacttttgccagcccgtaggcaaaccatgctcttttctgccacacaaactcgaaaa
gttgaagacttggcaagaatttctctgaaaaaggagcctttgtacgtgggtgttgatgac
gacaaagaggttgccacagtggatggccttgagcagggctatgttgtttgtccctctgag
aagaggttccttctgcttttcacattccttaagaagaaccggaagaagaaagtgatggtc
ttcttttcatcttgtatgtctgtgaaataccactatgagctgttgaactacattgacctt
cccgtcttggccatccatggaaagcaaaagcaaaataagcgaacaaccacgtttttccag
ttctgcaacgcggattcaggaatactgctgtgtactgatgtggcagccagagggctggac
atccccgaagtggactggattgttcagtacgaccctcccgatgaccccaaggaatacatt
catcgtgttggtagaacagccaggggcctgaatggaagagggcacgccctgctcatcctg
cgccctgaagagttgggtttccttcgttacttgaaacagtccaaggttccattgaatcag
tttgacttctcctggtctaaagtttctgatatccagtctcagctggaaaaactgatcgaa
aagaactactttctccacaagtctgcccaggaagcatacaaatcctacataagagcatat
gactctcactctctcaagcagatcttcaacgtgaacaacttaaatctgcctcaggttgct
ctgtcttttggttttaaggtccctccttttgttgatctgaatgtgagcagccatgatggc
aagcttaagaagagaggcggtggtggcggattcggctaccagaaaacaaagaaagtggag
aagtccaagatctttaaacacatcagtaagaagccagcagaccgcaggcagttctcacac
tga

DBGET integrated database retrieval system