KEGG   Mus musculus (mouse): 66948Help
Entry
66948             CDS       T01002                                 

Gene name
Acad8, 2310016C19Rik, AI786953
Definition
(RefSeq) acyl-Coenzyme A dehydrogenase family, member 8
  KO
K11538  isobutyryl-CoA dehydrogenase [EC:1.3.99.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    66948 (Acad8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     66948 (Acad8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 66948
NCBI-ProteinID: NP_080138
MGI: 1914198
Ensembl: ENSMUSG00000031969
Vega: OTTMUSG00000029982
UniProt: Q9D7B6 A0A0R4J0P1
Position
9; 9 A4
AA seq 413 aa AA seqDB search
MAMLRSGYRRFGCLRAALKSLAQTHHRSITFCIDPSLGLNEEQKGFQKVAFDFAAREMAP
NMAEWDQKELFPVDVMRKAAQLGFGGVYVRTDVGGSGLSRLDTSVIFEALATGCTSTTAY
ISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKQQGDH
YILNGSKAFISGGGESDIYVVMCRTGESGAKGISCIVVEKGTPGLSFGKKEKKVGWNSQP
TRAVIFEDCAVPVANRIGTEGQGFLIAMKGLNGGRINVASCSLGAAHASVILTQEHLKVR
KQFGAPLARSQYLQFQLADMATKLVASRLMIRTAAVALQEEREDAVALCSMAKLFATEEC
FAICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRNLLQD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgttgcggtccggatacaggcgctttggctgtctgcgcgcggcactcaagtcc
ctggctcagacccaccaccggagcatcaccttctgcatcgatccttccttggggctaaat
gaagaacagaaaggatttcagaaagtggcctttgactttgcagctcgggaaatggctccc
aatatggcggagtgggatcagaaggagctgttccctgtggatgtgatgcggaaggctgca
cagctgggatttgggggggtctatgtgcgaacagatgtgggtggatctggactgtctcgc
cttgatacttctgtcatctttgaagccttggccacaggctgcaccagcaccactgcctat
ataagcatccacaacatgtgtgcctggatgattgatagctttggaaatgaggaacagagg
cacaaattttgcccaccgctctgtaccatggagaagtttgcttcctactgcctcactgaa
ccaggcagtgggagtgatgctgcatctcttctgacctcagctaaacaacaaggagatcat
tacatcctcaatggttccaaggccttcatcagtgggggaggtgagtcagacatctatgtg
gtcatgtgccgaactggtgagtctggcgccaaaggtatctcctgcatagttgttgagaaa
ggaacccctggtctcagctttggcaagaaggagaagaaggtggggtggaactcgcagcca
acccgagcagtgatctttgaagactgtgctgtccctgtggccaacaggattgggaccgag
gggcagggttttctcatcgccatgaaaggactgaatggtggaaggatcaatgttgcatcc
tgctctctgggagccgctcatgcttcagttatcctaacccaagaacacctcaaggtccgc
aagcagtttggagcacctttggccagaagccagtacctccaattccagttggcagatatg
gccaccaagctagttgcttcccggctgatgatccgtactgcagcagtggctttgcaggaa
gagcgggaagatgcagtggccctgtgttccatggccaagctctttgctacagaggagtgc
tttgctatctgcaaccaggctttgcagatgcatgggggctacggctatctgaaggactat
gctgttcaacagtatatgcgggactccagggtccaccagatcctagaaggtagcaatgaa
gtgatgaggatgctgatctctcgaaacctgcttcaggactag

DBGET integrated database retrieval system