KEGG   Mus musculus (house mouse): 66953
Entry
66953             CDS       T01002                                 
Symbol
Cdca7, 2310021G01Rik, JPO1
Name
(RefSeq) cell division cycle associated 7
  KO
K23408  cell division cycle-associated protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    66953 (Cdca7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66953 (Cdca7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   Others
    66953 (Cdca7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    66953 (Cdca7)
SSDB
Motif
Pfam: zf-4CXXC_R1 TFIIE-A_C Spt5_N Ribosomal_60s PBP_dimer STPPase_N Myc_N WD40_2
Other DBs
NCBI-GeneID: 66953
NCBI-ProteinID: NP_080142
MGI: 1914203
Ensembl: ENSMUSG00000055612
UniProt: Q9D0M2
Position
2:72306531..72317236
AA seq 382 aa
MEARRARQKALKVKNLKDVRYMKLISMETSSSSDDSCDSFASDNFANTRLQLNREGCRTR
SQCRHSGPLRVAMKFPARNTRRAASKKAAPPKPSESSANDSHSDSEEEEEEEEEEDGMNF
LEKRALNIKQNKAMLAKLMSELESFPGLFSGRHSLPGHRAKDSKSPRRRTFPGVATRRNP
ERRTRPLTRSRSRILGSLGALPTEEEEEEEEEEEDKYMLVRQRKSMDSYMNDDDVPRSRR
PGSMTLPHIIRPVEEVTEEEIRNICSNSREKIYNRSLGSTCHQCRQKTTDTKTNCRNPDC
WGIRGQFCGPCLRNRYGEEVKDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAK
YHGFGNVHAYLKSLKQEFEMQA
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaggctcgccgcgcgcggcaaaaggctctcaaagtaaagaacttaaaggatgtcaga
tatatgaagttgatttccatggagacatcgtcctcctccgatgacagttgtgacagcttt
gcttctgataattttgcaaacacaagactgcagttgaacagggaaggctgcaggacccga
agtcagtgccggcactccgggcctctcagggtagcaatgaagtttccggcacgaaatacc
cggagggcggccagcaaaaaagcagcgcccccaaagccctctgagagctctgcaaacgat
tcccactctgactctgaagaagaagaagaagaagaagaagaagaagatggcatgaacttt
ctggagaagagagccttaaatataaagcagaacaaagcaatgcttgcaaaactcatgtca
gaattagaaagcttccctggcttgttctctggacgacattccctcccaggccacagagcc
aaagattcaaagtcgcctagacgacgcacattcccaggtgtggctaccagaaggaacccg
gaacggagaactcgacctcttaccaggtcaaggtcccggatcctgggctccttgggtgcc
ctgcccaccgaggaagaggaggaggaagaggaggaggaagaggataagtacatgctggtg
agacagaggaagtccatggacagctacatgaacgacgatgatgtgcccagaagtcggagg
cctggatccatgacccttccgcatataatccgaccagtagaagaagtcacagaggaagag
attaggaacatctgcagcaactcgagagagaagatttataaccgctctctgggttctaca
tgtcatcagtgtcgccagaaaaccactgacaccaaaaccaactgccgaaacccagactgc
tggggcatccggggccaattctgtggtccctgccttcgaaaccgctatggcgaggaggtc
aaggacgctctgctggatccgaattggcactgcccaccttgtcgaggaatttgcaactgc
agcttctgccgccagcgtgatgggcggtgcgccactggagtcctggtgtatctggcaaag
tatcatggcttcgggaacgtccatgcttacttgaaaagtctgaagcaggaatttgaaatg
caagcgtag

DBGET integrated database retrieval system