KEGG   Mus musculus (house mouse): 66958
Entry
66958             CDS       T01002                                 
Symbol
Tmx2, 2310042M24Rik, AA589631, Txndc14
Name
(RefSeq) thioredoxin-related transmembrane protein 2
  KO
K25112  thioredoxin-related transmembrane protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    66958 (Tmx2)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   Others
    66958 (Tmx2)
SSDB
Motif
Pfam: Thioredoxin
Other DBs
NCBI-GeneID: 66958
NCBI-ProteinID: NP_080144
MGI: 1914208
Ensembl: ENSMUSG00000050043
Vega: OTTMUSG00000013511
UniProt: Q9D710
Position
2:complement(84501655..84509172)
AA seq 295 aa
MAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCD
FDWREVEILMFLSAIVMMKNRRSITVEQHVGNIFMFSKVANAILFFRLDIRMGLLYLTLC
IVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADL
SLKYNCSGLNFGKVDVGRYTDVSTRYKVSTSPLTRQLPTLILFQGGKEVIRRPQIDKKGR
AVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPVDPAPTTVPDGENKKDK
NT seq 888 nt   +upstreamnt  +downstreamnt
atggctgtccttgcgcctctgattgctttggtgtactcggtgccgcggctttctcgatgg
ctggcccgaccttattgccttctgtctgctctgctttccattgctttcctcctcgtgagg
aaactgccaccgatttgcaatggtctccccacgcaacgcgaagatggcaacccgtgtgac
tttgactggagagaagtggagatcctgatgttcctcagtgccattgtgatgatgaagaac
cgcagatccatcactgtggagcaacatgtaggcaacatctttatgtttagtaaagtggcc
aacgccatccttttcttccgactggatattcgaatgggtctgctatacctcacactctgc
atagtgttcctgatgacctgcaagcccccgctgtacatgggtcctgagtatatcaagtac
ttcaatgataaaaccattgatgaggagctggagcgagacaagagggtcacttggattgtg
gagttctttgccaactggtctaatgattgccaatcctttgctcccatctatgcggacttg
tccctcaagtacaactgttcagggctaaattttgggaaggtagatgttggacgctacact
gacgttagcacacggtacaaagtgagcacatcacccctcaccagacagctccctaccctg
attctgttccaaggcggcaaggaggtcattcgtcggccgcagattgacaagaaaggacga
gctgtctcttggaccttttctgaggagaatgtgattcgagaattcaacttgaatgagcta
taccaacgagccaagaagcactcaaagggtggagacatgtcagaagagaagcctgtggac
cctgctcccactactgtgccagatggggaaaacaagaaggacaaatag

DBGET integrated database retrieval system