KEGG   Mus musculus (mouse): 66960
Entry
66960             CDS       T01002                                 

Gene name
Mindy3, 1810041E18Rik, 2310047O13Rik, 5830410F13Rik, AI447827, AW111958, Fam18, Fam188a
Definition
(RefSeq) MINDY lysine 48 deubiquitinase 3
  KO
K22647  ubiquitin carboxyl-terminal hydrolase MINDY-3/4 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66960 (Mindy3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     66960 (Mindy3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MINDY
    66960 (Mindy3)
SSDB
Motif
Pfam: DUF4205 EF-hand_7 PhageMetallopep
Other DBs
NCBI-GeneID: 66960
NCBI-ProteinID: NP_077147
MGI: 1914210
Ensembl: ENSMUSG00000026767
Vega: OTTMUSG00000011370
UniProt: Q9CV28
Position
2; 2 A1
AA seq 444 aa
MSEVTKELLELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAF
LLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDIVESAYDSSGSYCLVSWLRGRTPEEAAR
ISGSPAQSSCQVEHSSALAVEELGFERFHALIQKRSFRTVSELKDAVLDQYSMWGNKFGV
LLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECS
GMQLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAP
EAPSEQARRVFQTYDPEDNGFIADSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILL
GPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTPI
KRCLQTKWPYIELLWTTDRCPSLN
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtccgaagtgaccaaagagctgctggagctggtgtggggcaccaagagcagtcccgga
ctgtcggacaccatcttctgccgctggacgcaagggtttgtgtttagtgaatcagaggga
tctgcattagagcagtttgaaggtggcccctgtgctgttattgcacctgtccaggcgttt
cttttgaagaagcttctgttctcctccgagaagtcgtcctggcgggattgctcagaggaa
gagcagaaggagctcctttgtcacaccttgtgtgatattgtagagagtgcttatgacagc
tctggatcatactgcttggtttcatggttgagaggaaggacccccgaggaagcggctagg
atttctgggagtcctgcacagtctagttgccaagtggaacattcttctgccttggctgtc
gaagagcttggctttgagcgatttcatgcattaattcaaaaaagatcattcagaactgta
tcagaattaaaagatgctgtcttggaccagtattcaatgtggggaaacaaatttggagtc
ttgctttttctctattctgtattactgacaaagggcattgaaaacataaagaattcaatt
gaagatgcaaatgagcctttgatagaccctgtgtacgggcatggcagccaaagcttaatt
aacctcctactgacggggcatgcagtatctaatgtatgggatggtgatagagagtgctca
ggaatgcaacttctcggtatccatgaacaagcagctgtaggattcttaacactaatggaa
gctttacgatattgtaaggttggttcttacttgaaatctccaaaattccctatttggatt
gttggcagcgaaactcacctcaccgtattttttgccaaggatatggctttagttgcccct
gaagcgccttcggaacaagccagaagagttttccaaacctatgatccggaagataatgga
ttcatagctgactcccttctagaagatgtcatgaaagccttggaccttgtttcagatccc
gagtatataaatctcatgaagaataaattagatccagaaggactaggaatcatattgttg
ggtccatttcttcaagaattttttcctgatcagggctccagtggtccagaatcttttact
gtctaccactacaatggattgaagcagtcaaattataatgaaaaggtaatgtatgtggaa
gggactgcagtggttatgggttttgaagaccccatgctacagacagacgacactcctatt
aaacgctgtctgcaaaccaaatggccatacattgagttactgtggaccacagaccgctgt
ccttcgctcaactga

DBGET integrated database retrieval system