KEGG   Mus musculus (mouse): 66967
Entry
66967             CDS       T01002                                 

Gene name
Edem3, 2310050N11Rik
Definition
(RefSeq) ER degradation enhancer, mannosidase alpha-like 3
  KO
K10086  ER degradation enhancer, mannosidase alpha-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66967 (Edem3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    66967 (Edem3)
Lectins [BR:mmu04091]
 M-type lectins
  66967 (Edem3)
SSDB
Motif
Pfam: Glyco_hydro_47 PA Glyco_hydro_127
Other DBs
NCBI-GeneID: 66967
NCBI-ProteinID: NP_001034733
MGI: 1914217
Ensembl: ENSMUSG00000043019
Vega: OTTMUSG00000049645
UniProt: Q2HXL6
Position
1; 1 G1-G2
AA seq 931 aa
MSKAGGCRGCGCRVPQRASWSLVAATAALCLVLATSVCTAGAAPMSREEKQKLGNQVLEM
FDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNK
TKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEHMQWYNDEL
LHMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAAL
SRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYL
LKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQ
VLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGD
PYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKED
IIFDIEDYIFTTEAHLLPLWLSTTNRSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDP
LYAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSL
IHLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIISHPFFG
RVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEK
ARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAI
REHEQVEVLLSDKARDRDPEMENEDQPSSENDSQNQSAEQMLSLSQTVDLADKESPEHPA
DSHSEASPSDSEEAAGFAPSEQISGSTENHETTSLDGECTDLDNQVQEQSETEEDSSPNV
SWGTKAQPIDSILADWNEDIEAFEMMEKDEL
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgagcaaagccggcggctgccggggctgtgggtgccgggtcccccagcgagcgtcatgg
agcctggtggcagcgacggccgcgctctgtctggtgttggccacgtccgtgtgcacggca
ggggccgcgcccatgagtagggaagagaagcagaagcttggaaatcaagtcctggaaatg
tttgatcatgcttatggcaactatatggaacatgcctacccagctgatgagctcatgcct
ttaacctgccggggccgtgtcagaggccaggagcccagccggggcgatgtggatgacgcc
ttgggaaagttttccctaacactgattgattctttggacactcttgtggtattaaacaaa
actaaggaatttgaagatgctgtgagaaaagttttaagggatgttaatttagataatgat
gtagttgtttcagtcttcgaaacaaacatcagagttcttgggggtcttttgggcggacac
tcgctggccatcatgctgaaggagaaaggcgagcacatgcagtggtacaatgacgagctc
ctccacatggcaaagcagctgggttacaagctcctgccagctttcaacaccaccagcggc
cttccgtaccccaggattaatttaaagtttggcatcagaaaaccagaagccaggacggga
acagagacagacacctgtacagcctgtgcaggcaccttgatcctcgagtttgctgcactg
agtcgattcacaggagcgaccatatttgaggaatatgcaagaaaagctcttgattttctc
tgggagaaaagacagcgaagtagcaatttagtaggcgtgactatcaatattcatactgga
gactgggtacgcaaagatagtggagttggagcggggatcgactcctattatgagtatctg
ttgaaagcctatgtcttgcttggagatgacagttttctggaaagatttaatacacattac
gatgccataatgaggtatataagccagccacctctcctacttgatgtgcatatccacaaa
ccaatgctgaacgctcggacctggatggatgcattgcttgccttttttccaggtttgcag
gttttaaagggtgatattagacctgctattgaaactcacgaaatgttataccaggtgatt
aaaaaacacaattttctaccagaggcatttactacagatttcagggtccattgggctcag
catcctttaaggccagagtttgcagaaagtacctacttcttatataaggctacaggagac
ccttactaccttgaagtagggaaaacacttattgaaaatttgaataagtatgctcgagtg
ccttgcgggtttgctgccatgaaggatgttcgcactgggagtcatgaggacagaatggat
tcattcttcttggctgaaatgtttaaatacctgtacctgttatttgctgataaagaggac
atcatttttgacatagaagactatatctttacaacagaagctcatctgttaccgctttgg
ctttccaccacaaaccgaagcatctcaaagaagaacacaacctcagaatacacagaactg
gatgatagtaattttgattggacttgtccaaacactcagattctttttcctaatgatcca
ttgtatgctcagagcatccgtgaacccttgaaaaacgtggtggataagagctgtccgaga
ggcatcatcagagtagaggagagtttcagaagtggagctaagcctcctctgagagccaga
gattttatggccactaaccctgaacatttagaaatcctgaagaagatgggggtgagtttg
attcacctcaaagatgggcgagtccagctggtccaacatgcaatccaagctgctagttca
attgatgctgaagatgggttacggttcatgcaggagatgatagagctgtccagtcagcaa
cagaaggagcagcagctgcctccacgagctgtccagattatctcccacccgttttttggc
agggtcgtcttaactgctggaccagctcagtttgggctggatctatctaaacacaaagag
acacgaggatttgttgcaagcagtaaaccatataatggttgttcagagctcactaaccct
gaggcagtgatgggaaaaattgccttgatacaaagaggacagtgcatgtttgcagaaaag
gcacgcaacattcagaatgctggcgccatcggtggcattgtgatcgatgacaacgagggg
agcagtagcgacacggcccccctgttccagatggccggcgatgggaaggacacagacgac
atcaagatccccatgctgttcctgttcagcaaggaaggcagcatcatcctggacgccatc
cgcgagcacgagcaggtggaggtgctcctttctgacaaagcgagagaccgagatcccgaa
atggaaaatgaagaccagccatcttctgaaaatgattctcagaatcagagcgcagagcag
atgctctcgctttctcagacagtcgacttggctgataaggagagccctgaacaccctgca
gattctcactcagaggcgtctccatcggacagtgaagaggctgctggctttgccccctct
gaacagatatctgggtccaccgaaaaccacgagactacaagccttgatggtgaatgtaca
gacttagataaccaagttcaagaacaatcagaaactgaggaagattccagtcctaatgtc
agctggggtacaaaggcccagcctatagactccatattagcagactggaatgaagacata
gaagcatttgaaatgatggagaaggatgaactatga

DBGET integrated database retrieval system