KEGG   Mus musculus (mouse): 66973
Entry
66973             CDS       T01002                                 

Gene name
Mrps18b, 2400002C15Rik, MRP-S18-2, S18mt-b
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    66973 (Mrps18b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    66973 (Mrps18b)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    66973 (Mrps18b)
SSDB
Motif
Pfam: Ribosomal_S18 HTH_21
Other DBs
NCBI-GeneID: 66973
NCBI-ProteinID: NP_080154
MGI: 1914223
Ensembl: ENSMUSG00000024436
Vega: OTTMUSG00000037410
UniProt: Q99N84
Position
17; 17 B1
AA seq 254 aa
MAAPLRHTLLKLVPTLLRSSYVAQVPLQTLCTRGPPEEDAPSSLPVSPYESEPWKYLDSE
EYHNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRNNKVAGNPCPICRDHKLHVDFRNVKL
LEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADFGTVHG
AVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTP
PAESSIEQPGSQSA
NT seq 765 nt   +upstreamnt  +downstreamnt
atggctgcccccttgcggcacacgcttctaaagctggttcctacactcttacgaagttcc
tatgtagctcaggttcccctccagactctttgcaccagaggccctcctgaagaagatgct
ccatcctcgcttcccgtttccccatatgagagcgagccttggaagtacctggattcagaa
gaataccacaaccgctatggctctcgccctgtttgggctgactaccgccgcaaccacaaa
ggtggtgtgccaccacagcggacccgaaagacatgtattcgtaacaataaagttgctggg
aatccttgcccaatctgccgggatcacaagttgcatgttgactttaggaatgtgaagctc
ttggaacagtttgtctgtgcacacacgggtatcatctttcacgccccatacacaggggtc
tgtatgaagcagcacaagaagctgacccaggccatccagaaagccagggagtgtggtctt
ctcagttactacgtcccccaggttgagccccgggatgctgactttggtactgtgcatgga
gctgtcagtgtgactccaccagcccccacactgttgtcaggtgaaccttggtacccatgg
tacagctggcaacagccaccagagagagagctgtctcgccttcgccgactctatcaagga
aatctcctagaagaaagtggcccgccacctgagtcgatgccagagatgcccactacacca
ccagcagaatcctccattgagcagccaggctcccagagtgcttag

DBGET integrated database retrieval system