KEGG   Mus musculus (mouse): 66979
Entry
66979             CDS       T01002                                 

Gene name
Pole4, 2400007P05Rik, 5830430F06Rik
Definition
(RefSeq) polymerase (DNA-directed), epsilon 4 (p12 subunit)
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    66979 (Pole4)
   03410 Base excision repair
    66979 (Pole4)
   03420 Nucleotide excision repair
    66979 (Pole4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    66979 (Pole4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66979 (Pole4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     66979 (Pole4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    66979 (Pole4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      66979 (Pole4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAF CENP-T_C
Other DBs
NCBI-GeneID: 66979
NCBI-ProteinID: NP_080158
MGI: 1914229
Ensembl: ENSMUSG00000030042
Vega: OTTMUSG00000023086
UniProt: Q9CQ36
Position
6; 6 C3
AA seq 118 aa
MAAAAAAGSGTPREEEAPGGEAAASQAQAPTSAPGGVRLSRLPLARVKALVKADPDVTLA
GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggctgctgggagcgggacgcccagagaggaagaggctcccggaggg
gaggcagcggcttcgcaggcccaagccccgacgagtgcacccgggggagttcgcctctcg
aggctgcctctggcgagagtaaaggccttggtgaaggcagaccctgacgtaacgctggcg
ggacaggaagccatctttatcctggcgcgtgccgcggaactgttcgtggagactatcgca
aaagatgcctactgctgtgctcaacaaggaaagaggaaaactctccagaggagagatttg
gataatgcaatagaagctgtggatgaattcgcttttctagaaggcactttggattaa

DBGET integrated database retrieval system