KEGG   Mus musculus (mouse): 66990Help
Entry
66990             CDS       T01002                                 

Gene name
Tmem134, 2410001H17Rik, AI463452
Definition
(RefSeq) transmembrane protein 134
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF872 DUF308 DUF2207
Motif
Other DBs
NCBI-GeneID: 66990
NCBI-ProteinID: NP_001072117
MGI: 1914240
Ensembl: ENSMUSG00000024845
UniProt: Q8R0J4
Position
19; 19 A
AA seq 195 aa AA seqDB search
MSAARPQFSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNL
ENDEDGAQASPEPDGGVSTRDSGHMSVRSSQWSFSTISSSTQRSYNACCSWTQHPLIQKN
RRVVLASFLLLLLGLVLILVGVGLEVAPSPGVSSAIFFVPGILLLVPGVYHVIFIYCAVK
GRRGFQFFYLPYFEK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcccggccccagtttagcatcgatgatgccttcgagctgaccctggaggac
gcggggcctgagcccgagtccagcggggtcgcccgcttcgggccgctgcacttcgaacgc
cgggctcggttcgaggtggctgatgaagacaagcagtcccggctacgctaccagaacctg
gaaaatgatgaggacggagcccaggcctctccggagccggatgggggagtcagcaccagg
gattctgggcacatgtctgtccgcagctcgcagtggtccttcagcaccatcagcagcagc
acacagcgctcctacaacgcctgctgcagctggacccaacatcctttgatccagaaaaac
cgccgggtagtgctggcctccttcctgcttctgctgttggggctagtgcttatcctggtc
ggcgtgggactggaggtggccccctctccaggtgtctccagtgccatcttctttgtgccg
ggcatcctgctgttagtcccaggagtctaccatgtgatcttcatctactgcgctgtcaag
ggccgccggggcttccaattcttctacctgccctactttgagaagtga

DBGET integrated database retrieval system