KEGG   Mus musculus (mouse): 66997
Entry
66997             CDS       T01002                                 

Symbol
Psmd12, 1500002F15Rik, AI480719, P55
Name
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    66997 (Psmd12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    66997 (Psmd12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66997 (Psmd12)
   05012 Parkinson disease
    66997 (Psmd12)
   05014 Amyotrophic lateral sclerosis
    66997 (Psmd12)
   05016 Huntington disease
    66997 (Psmd12)
   05017 Spinocerebellar ataxia
    66997 (Psmd12)
   05020 Prion disease
    66997 (Psmd12)
   05022 Pathways of neurodegeneration - multiple diseases
    66997 (Psmd12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    66997 (Psmd12)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     66997 (Psmd12)
SSDB
Motif
Pfam: PCI RPN5_C Hydrophob_seed SIX1_SD
Other DBs
NCBI-GeneID: 66997
NCBI-ProteinID: NP_080170
MGI: 1914247
Ensembl: ENSMUSG00000020720
Vega: OTTMUSG00000003659
UniProt: Q9D8W5
Position
11; 11 E1
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPV
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTENLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKSRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggtggctcggagcgggccgatgggcgcattgtgaagatggaagtggactac
agcgccacggtggaccagcgcctgcctgagtgcgagaagctggccaaggaagggcggctt
caagaagtcatcgaaacccttctctctctagaaaagcagacccggactgcctctgacatg
gtgtccacgtcccgcatcttggttgcagtagtgaaaatgtgctatgaggctaaagaatgg
gacttacttaatgaaaatattatgcttctgtcaaaacgacggagtcagttaaaacaagca
gttgcaaaaatggttcagcagtgctgtacttacgtggaggagatcacagacctgccagtc
aagctgcgattgattgatactctgcggatggttacagaaggaaagatttatgttgaaatt
gagcgtgctcggctgactaaaaccttagcaactattaaagagcaaaatggcgatgtgaaa
gaggctgcctccatccttcaagagttacaggtggaaacctatgggtccatggagaagaag
gagcgagtggaattcattctggagcagatgagactctgcctagctgtgaaggattacatt
cgcacacagatcattagcaaaaaaattaataccaaattcttccaagaagaaaacacagag
aacttgaagttgaagtactataacttaatgattcagctggatcagcacgaggggtcctat
ctgtccatctgcaaacactacagagccatctatgacactccctgcattcaggcagaaagt
gacaagtggcagcaggctctgaaaagtgttgttctctatgttatcctggctccttttgac
aatgagcaatcagatttggttcaccggataagcagtgacaagaagctggaagaaattccc
aaatacaaggatctgctgaagctttttaccaccatggagctgatgcgctggtccactctt
gttgaggactatggggtggagctgcgaaaaggctcctcagagaccccggcgactgacgtt
ttcagctctacagaagaaggggaaaagaggtggaaagacttgaagagcagagtggtggag
cacaacatcagaattatggccaagtactacactcggataacaatgaaaaggatggcacaa
cttctggatctctctgtggatgagtcagaggctttcctctcgaatctagtcgttaacaag
accatctttgctaaagtagacaggttggctggagtcatcaacttccagagacccaaggat
ccaaataatttattaaatgactggtctcagaaactgaactcgctgatgtctctggttaac
aaaacgacacacctcatagccaaagaggagatgatacataatctacaatga

DBGET integrated database retrieval system