KEGG   Mus musculus (house mouse): 67003
Entry
67003             CDS       T01002                                 
Symbol
Uqcrc2, 1500004O06Rik
Name
(RefSeq) ubiquinol cytochrome c reductase core protein 2
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67003 (Uqcrc2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    67003 (Uqcrc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    67003 (Uqcrc2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    67003 (Uqcrc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67003 (Uqcrc2)
   05012 Parkinson disease
    67003 (Uqcrc2)
   05014 Amyotrophic lateral sclerosis
    67003 (Uqcrc2)
   05016 Huntington disease
    67003 (Uqcrc2)
   05020 Prion disease
    67003 (Uqcrc2)
   05022 Pathways of neurodegeneration - multiple diseases
    67003 (Uqcrc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67003 (Uqcrc2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67003 (Uqcrc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    67003 (Uqcrc2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   67003 (Uqcrc2)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C YdgH_BhsA-like
Other DBs
NCBI-GeneID: 67003
NCBI-ProteinID: NP_080175
MGI: 1914253
Ensembl: ENSMUSG00000030884
UniProt: Q9DB77
Structure
Position
7:120234412..120258746
AA seq 453 aa
MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSR
IGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDV
AYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNM
RGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIK
RGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKA
VAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVA
DADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagctcctcagcagggccgggtccttctcgagattttattccctcaaagttgccccg
aaggttaaaacttcagcagcccctggaggagtgcctctgcagcctcaggatcttgagttt
accaaattaccaaatggtttggtgattgcttctctggaaaactatgctcctctgtcaaga
atcggcttgttcgttaaagcaggcagtagatatgaggactccaacaacttgggaacctca
catttactacgtcttgcatctagtttgactaccaaaggagcttcatctttcaagataacc
cgtgggattgaagcagttggtggtaaattaagtgtgactgcaacaagggaaaacatggcg
tacactgtagaaggcattcggagtgatattgagatcctcatggagttcctgctcaatgtc
accacagcacccgagtttcgccgttgggaagtagctgccctgcggtctcagctaaagatt
gacaaagctgttgcctttcagaattcacagacccgtatcattgagaacttgcatgatgtt
gcctacaagaatgccttggctaatcctttgtactgtcctgactataggatggggaagata
acatcagaggaattacattactttgttcagaaccacttcacaagtgcaagaatggctctg
gttggacttggtgtgagtcattctgtcttaaagcaggtggctgaacaatttctcaacatg
aggggtggccttggtttagctggtgcaaaagccaaataccgtggaggtgaaattagagag
cagaatggagacaacctggtccatgctgctattgttgcagaaagtgctgccattggaaat
gcagaggcaaatgcattcagtgtacttcagcatcttcttggtgctggaccacatatcaaa
aggggcaacaacaccaccagcctcctgagccagagtgttgccaaaggaagtcaccagcct
tttgatgtttctgcatttaatgccagttactcagactctgggctctttggaatttacact
atttcccaggctgcagctgctggagaggttatcaatgctgcctacaaccaagtcaaagca
gttgctcaaggaaacctttccagtgcagatgtccaagctgccaagaacaagctaaaagct
ggatatctaatgtctgtggagacgtcagagggcttcctgagtgaaattgggtcacaggct
ctagctgcaggttcttatatgccaccttctaccgtccttcaacagattgactccgtggct
gatgctgatgttgtaaaggctgcaaaaaagtttgtttctggcaagaagtcaatggcagcg
agtggaaacttgggacatacgccttttctcgacgagttataa

DBGET integrated database retrieval system