KEGG   Mus musculus (mouse): 67005
Entry
67005             CDS       T01002                                 

Gene name
Polr3k, 12.3kD, 12.3kDa, 1500004O14Rik, AI196849, AU014893, C11, RPC, RPC10, RPC11
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide K
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67005 (Polr3k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67005 (Polr3k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67005 (Polr3k)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67005 (Polr3k)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Lar_restr_allev Nudix_N_2 zf-SAP30 Baculo_LEF5_C Zn_ribbon_recom
Other DBs
NCBI-GeneID: 67005
NCBI-ProteinID: NP_080177
MGI: 1914255
Ensembl: ENSMUSG00000038628
Vega: OTTMUSG00000016835
UniProt: Q9CQZ7 Q3TSW1
Position
2; 2 H4
AA seq 108 aa
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
NT seq 327 nt   +upstreamnt  +downstreamnt
atgctgttgttctgcccgggctgcgggaacggactcattgtggaggaggggcagcgttgc
catcgcttcgcctgcaacacttgcccctacgtccataatatcacccgtaaggtaacaaac
cgaaagtatccaaagctaaaagaagtggacgacgtgcttggtggagcagctgcatgggag
aatgtggactctactgcagagccatgtccaaaatgcgaacatccccgtgcctacttcatg
cagcttcagacgcgttctgcagacgagccaatgaccaccttctataagtgctgcaatgct
cagtgtggacatcgctggagggattaa

DBGET integrated database retrieval system