KEGG   Mus musculus (mouse): 67010
Entry
67010             CDS       T01002                                 

Gene name
Rbm7, 1200007M24Rik, 1500011D06Rik, AU041934, AW554393
Definition
(RefSeq) RNA binding motif protein 7
  KO
K13188  RNA-binding protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67010 (Rbm7)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    67010 (Rbm7)
SSDB
Motif
Pfam: RRM_1 RRM_5
Other DBs
NCBI-GeneID: 67010
NCBI-ProteinID: NP_659197
MGI: 1914260
Ensembl: ENSMUSG00000042396
Vega: OTTMUSG00000063008
UniProt: Q9CQT2 Q14A95
Position
9; 9 A5.3
AA seq 265 aa
MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHE
VSVPYAMNLLNGIKLFGRPIKIQFRSGSSHASQDASVSYPQHHVGNLSPTSTSPNSYERT
VGNVSPTAQMVQRSFSSPEDYQRQAVMNSVFRQMSYAGKFGSPHADQLGFSPSAQPHGHT
FNQSSSSQWRQDALSSQRKRQNSHPYLADRHYSREQRYSDHGSDYHYRGSREDFYYDDRN
HDGWSHDYDNRRDSSRGGKWPSSRH
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggggcggcggccgcagaggccgaccgcactctgttcgtgggtaacctggagacgaag
gtgacagaggagctcctcttcgagctgttccaccaggctgggccggtaataaaagtgaaa
atcccgaaagataaagatggcaaactgaagcagtttgcattcgtgaacttcaaacatgaa
gtgtctgttccctatgccatgaatctgctcaacggaatcaaacttttcgggaggcctatc
aaaattcagtttagatcaggaagcagtcacgcctctcaggatgccagtgtgtcatatccc
cagcatcatgttggaaatttaagcccaacctccacatctcctaacagctatgaaaggaca
gtgggtaacgtgtctccgacagctcagatggtccagaggtccttttcttctccagaagat
tatcagcggcaagcagtgatgaacagtgttttcagacagatgtcatatgctgggaaattt
ggttctccacatgcggatcagttgggattttcaccatcagctcaaccacatggccatacc
tttaaccagtcttccagctcccagtggcgccaagatgcactgtcatcacagcgtaaaaga
cagaattctcacccctacctagcagatagacactatagccgtgagcagcgctactctgac
catgggtctgactatcattacagaggcagccgagaggatttctactatgacgacaggaat
catgatggctggagccatgactatgataacagaagggacagtagtagaggtgggaagtgg
ccctcatccagacactaa

DBGET integrated database retrieval system