KEGG   Mus musculus (mouse): 67037
Entry
67037             CDS       T01002                                 

Gene name
Pmf1, 2600009M07Rik, AL033286, AW060657
Definition
(RefSeq) polyamine-modulated factor 1
  KO
K11546  polyamine-modulated factor 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67037 (Pmf1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      67037 (Pmf1)
SSDB
Motif
Pfam: Nnf1 SYCP2_ARLD Mod_r Ku_PK_bind TSC22 TetR_C_4 DUF4618 Uso1_p115_C betaPIX_CC QueF Wtap HisKA_3 SlyX DUF16
Other DBs
NCBI-GeneID: 67037
NCBI-ProteinID: NP_080204
MGI: 1914287
Ensembl: ENSMUSG00000028066
Vega: OTTMUSG00000052145
UniProt: Q9CPV5
Position
3; 3 F1
AA seq 202 aa
MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQKLVADRSYERFTTCYK
HFHQLNPEVTQRIYDKFVAQLQTSIREEISEIKEEGNLEAVLNSLDKIIEEGRERGEPAW
RPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAVLAGRRQVEELQQQVRAL
QQTWQALHREQRELLSVLRAPE
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgaggtgagccgagatagcgaggctgcggaaagggggcctgagggctcctctccg
gaagctgtgccaggggacgcgaccatccccagggtgaaactcctggacgccatagtagac
actttcctccagaagctagtcgccgacaggagctacgagaggttcaccacctgctacaaa
cacttccaccagttgaaccctgaggtgacgcagaggatctatgacaagtttgtggctcag
ttgcagacatccatccgcgaggaaatctcagaaatcaaagaggaggggaacctagaagct
gtcctgaactccctggataagatcatagaagaaggcagagagcgcggagagccagcctgg
cgacccagtggaatcccagagaaagacctgtgtagtgtcatggcaccctacttcctgaag
caacaggataccctgtgtcatcaagtacggaaacaggaagccaagaaccaggaactggcc
gacgctgtcctggccgggcgcaggcaggtggaggagctgcagcagcaggttcgggccctc
cagcaaacatggcaggctctacacagagagcagagggagctgctgtcagtgctgagggcg
cctgagtga

DBGET integrated database retrieval system