KEGG   Mus musculus (mouse): 67038
Entry
67038             CDS       T01002                                 

Symbol
Ly6m, 2010109I03Rik
Name
(RefSeq) lymphocyte antigen 6 complex, locus M
  KO
K06846  lymphocyte antigen 6 complex locus protein D/E/F/G6/H
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    67038 (Ly6m)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  67038 (Ly6m)
SSDB
Motif
Pfam: Toxin_TOLIP UPAR_LY6
Other DBs
NCBI-GeneID: 67038
NCBI-ProteinID: NP_080205
MGI: 1914288
Ensembl: ENSMUSG00000063522
Vega: OTTMUSG00000045123
UniProt: Q9CQ11
Position
15; 15 D3
AA seq 111 aa
MRTHLLWLLPLILLGSSAQALKCHECSGIEDCYKPKTCSSQSLYCLTNWYTPPGQQTTVT
KTCAYTCPDINHVTANSKSSCCNTDLCNSARNLHVSWGLLALGLCYIYLSQ
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaggactcacctgctttggttgttgcccctgattctgctgggatcctctgcccaggcg
ttgaagtgtcatgaatgcagtggtatagaggactgctacaagcctaagacttgctccagc
cagagcctctactgcttgaccaactggtatacaccgccaggtcagcaaacgactgtgaca
aaaacatgtgcatatacctgccctgacattaatcatgtcacagccaactccaagtcctcc
tgctgcaacacggacctctgcaatagtgccaggaacctccacgtcagttggggattgctg
gccctcggcctctgctatatctatctcagccagtag

DBGET integrated database retrieval system