KEGG   Mus musculus (mouse): 67041Help
Entry
67041             CDS       T01002                                 

Gene name
Oxct1, 2610008O03Rik, Oxct, Oxct2a, Scot-s
Definition
(RefSeq) 3-oxoacid CoA transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    67041 (Oxct1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    67041 (Oxct1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    67041 (Oxct1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     67041 (Oxct1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 67041
NCBI-ProteinID: NP_077150
MGI: 1914291
Ensembl: ENSMUSG00000022186
Vega: OTTMUSG00000024748
UniProt: Q9D0K2
Position
15; 15 A1
AA seq 520 aa AA seqDB search
MAALKLLSSGLRLGASARSSRGALHKGCVCYFSVSTRHHTKFYTDPVEAVKDIPNGATLL
VGGFGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGENA
EFERQFLSGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAGT
TVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSLRKEGDGKGKSGKPGGD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYPLKDEAD
ADLINAGKETVTVLPGASFFSSDESFAMIRGGHVNLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKGVFDVDK
KNGLTLIELWEGLTVDDIKKSTGCDFAVSPNLMPMQQIST
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcaaactcctgtcctctgggcttcggctcggcgcctcagcccgcagctcg
cggggcgccctgcataaggggtgtgtctgctacttctctgtcagtactcgtcaccacacc
aaattttacacagatcccgtggaagctgtaaaagatattcctaatggtgcaaccttgctg
gttggtggttttgggctgtgtggtattccagagaatcttataggagctttactgaagact
ggagtaaaagatctaactgcagtcagcaacaatgcaggggttgacaacttcggcctgggc
cttttacttcgatccaagcagataaaacgaatgatctcctcatatgtgggagaaaatgca
gaatttgagcgacagttcctttctggtgaattagaagtagagctgacacctcagggcaca
cttgccgagaggatccgtgccggtggagctggagtccctgccttctacaccagcacaggg
tatgggactctggtacaggaaggaggatcacccatcaaatataacaaagatggcagtgtt
gccattgccagcaagccacgagaggtgagggagtttaacggtcagcacttcattttggag
gaagccatcacgggagattttgctctggtgaaagcatggaaagcagaccgggcaggcaat
gtgattttcaggaaaagtgcaagaaacttcaatctgccaatgtgcaaagctgcaggaact
accgtggtggaggttgaagaaattgtagacattggctcatttgccccagaagatatccac
attccaaagatttatgtgcaccgcctcataaagggagagaaatatgagaagagaattgag
cgtttatcactccgaaaggaaggagatggaaaaggcaaatccggtaagcctggaggcgat
gtgagggaacggatcatcaagcgagccgccctggagtttgaggacggcatgtacgctaac
ttgggtattgggattcctcttctggccagcaacttcatcagtcccaacatgactgttcat
cttcaaagtgaaaatggagtcttgggcctgggcccatacccactgaaagacgaagctgat
gcggatctcatcaatgcaggaaaggaaacagttactgttctcccaggagcctctttcttc
tccagcgatgagtcattcgccatgattagagggggacatgtcaatctaacaatgttagga
gccatgcaggtttctaagtatggtgacctggccaactggatgatacctggaaaaatggtg
aaaggaatgggaggagctatggatttggtgtccagttccaaaaccaaagtggtggtcacc
atggagcactctgcgaagggaaatgctcataaaatcatggagaaatgtacactaccactg
acgggcaaacagtgtgtcaaccgcatcattacagaaaagggtgtgtttgacgtggacaag
aaaaatggtttgacactgattgagctctgggaaggcctgactgttgatgacatcaagaag
agcacaggctgtgactttgcagtttcaccaaacctcatgccaatgcagcagatttcaact
tga

DBGET integrated database retrieval system