KEGG   Mus musculus (house mouse): 67043
Entry
67043             CDS       T01002                                 
Symbol
Syap1, 2010110O17Rik, AW011796, BSTA
Name
(RefSeq) synapse associated protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: BSD RlaP DUF2340
Other DBs
NCBI-GeneID: 67043
NCBI-ProteinID: NP_080208
MGI: 1914293
Ensembl: ENSMUSG00000031357
UniProt: Q9D5V6
Position
X:complement(161639839..161671458)
AA seq 365 aa
MFGGLSSWLGLKPPEGAAAEGEEPPSRDGDKLSAGAAPSEESPERPVEPTEEQQQQPPTE
DPQFLHQAKGLGNYLYNFASAATKKITESVTETAQTIKKSVEEGKIDDILDKTILGDFQK
EQKKFVEEQNTKKSEAAVPPWVESHDEETIQQQILALSADKRNFLRDPPAGVQFNFDFDQ
MYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRISLIKQSAQLTALAAQQQASG
KEEKSSNRDDNLPLTEAVRPKTPPVVIKSQLKSQEDEEEISTSPGVSEFVSDAFDTCSLN
QEDLRKEMEQLVLDKKQEEATALEEDSTDWEKELQQELQEYEVVAESEKRDENWDKEIEK
MLQES
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgttcggagggttgagcagttggctgggcttgaagccgcccgagggggcggcggcggag
ggagaagagcctcccagccgggacggggacaagctgtccgcgggagccgcgccttctgag
gagagccccgagcggcccgtggagcccactgaggagcagcagcagcagccgccgacggag
gacccacagttcctccaccaggccaaaggccttggcaattatttgtataactttgcaagt
gctgcaacaaagaagataactgaatctgttacagaaacagctcagacaatcaagaaatcc
gtggaagaaggaaaaatagatgatatccttgacaagactattttaggagattttcaaaaa
gaacagaaaaaatttgttgaggaacagaatacaaaaaagtcagaagcagctgtgcctccg
tgggttgagagtcatgatgaagagacaattcaacagcagattttggctttatcagctgac
aagaggaatttcctccgtgacccaccagctggtgtgcagtttaactttgactttgatcag
atgtaccctgttgccctggtcatgctccaagaggatgagctactaagcaagatgagattt
gcccttgttcctaaacttgtgaaggaagaagtattctggaggaactacttctaccgaatc
tccctgattaagcagtcggcccaactcactgcactggccgctcagcagcaagcctctgga
aaggaggaaaaaagcagcaacagagatgataacttgcctctgacagaggcagtacggccc
aaaacaccacctgtcgtaatcaaatctcagcttaaaagtcaagaggatgaagaggaaatc
tctactagcccaggagtttctgagtttgttagtgatgccttcgatacgtgcagcttaaat
caggaggatttaagaaaggaaatggaacaacttgtgcttgataagaagcaagaggaagca
actgcactagaagaagattctactgattgggaaaaggagctacaacaggagcttcaggaa
tatgaagtggtagcagagtctgagaagcgagatgaaaactgggataaagaaattgagaag
atgcttcaggagagttaa

DBGET integrated database retrieval system