KEGG   Mus musculus (house mouse): 67052
Entry
67052             CDS       T01002                                 
Symbol
Ndc80, 2610020P18Rik, HEC, HEC1, Kntc2
Name
(RefSeq) NDC80 kinetochore complex component
  KO
K11547  kinetochore protein NDC80
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67052 (Ndc80)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      67052 (Ndc80)
    NMS complex
      67052 (Ndc80)
SSDB
Motif
Pfam: Ndc80_HEC DUF5595 bZIP_1 ADIP DUF724 ATG17_like
Other DBs
NCBI-GeneID: 67052
NCBI-ProteinID: NP_075783
MGI: 1914302
Ensembl: ENSMUSG00000024056
UniProt: Q9D0F1
Position
17:complement(71803095..71833852)
AA seq 642 aa
MKRSSVSTCGAGRLSMQELRTLDLNKPGLYTPQTKERSTFGKLSTHKPTSERKVSIFGKR
TSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLYEFLTENGYVYSVSMKSLQAP
STKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKALGYPFTLSKSSMYTVGAPHTWPH
IVAALVWLIDCIKIDTAMKESSPLFDDGQLWGEETEDGIKHNKLFLEYTKKCYEKFMTGA
DSFEEEDAELQAKLKDLYKVDASKLESLEAENKALNEQIARLEEEREREPNRLMSLKKLK
ASLQADVQNYKAYMSNLESHLAVLKQKSNSLDEEIGRVEQECETVKQENTRLQSIVDNQK
YSVADIERINHEKNELQQTINKLTKDLEAEQQQMWNEELKYARGKEAIEAQLAEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRTQVYAPLKELLNESEEEINKALNKKR
HLEDTLEQLNTMKTESKNTVRMLKEEIQKLDDLHQQAVKEAEEKDKKSASELESLEKHKH
LLESGVNDGLSEAMDELDAVQREYQLTVKTTTEERRKVENNLQRLLEMVATHVGSLEKHL
EEENAKADREYEEFMSEDLLENIREMAEKYKRNAAQLKAPDK
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgaagcgcagttcagtttccacctgtggtgctggccgcctctctatgcaggagttaagg
accctggacctcaataagccaggcctttatacccctcaaaccaaagaaagatcaaccttt
ggaaagctgagtacacacaaaccgacatcggaaagaaaagtctcaatatttgggaaaagg
actagcggacatggatccaggaatagtcaacttggtatattttccagttctgaaaaaatc
aaggacccaagaccacttaatgacaaagcattcattcagcagtgtattcgacaactctat
gagtttcttacagaaaacggttatgtgtatagtgtatccatgaagtctctgcaagctcca
tccactaaagagttcctaaagatcttcgcctttctttatggctttctgtgcccgtcgtat
gaacttcctggtacaaaatgtgaagaagaggtcccaagaatttttaaagcacttgggtat
cccttcacactgtccaagagctccatgtatacagtgggagcccctcacacgtggcctcac
atcgtggctgccttggtgtggctcatagactgcatcaagattgatactgccatgaaagaa
agctcacctttatttgatgatgggcagctctggggagaagagactgaagatggaattaaa
cacaataagttgtttttggagtacaccaaaaagtgctatgagaagttcatgaccggggcc
gacagctttgaagaagaggatgctgagctgcaggcgaagctgaaggacttgtacaaggta
gatgcgtctaagctggagtcactcgaagcagaaaacaaagcactaaatgaacagattgca
agactggaggaggaaagagaaagagaaccgaaccgtctgatgtcattgaagaaactgaaa
gcgtccttacaagcagatgttcaaaactataaagcatacatgagcaacttggagtctcat
ttagccgtcctgaaacagaaatcgaatagtcttgatgaagaaattggtagagtagaacaa
gaatgtgaaactgttaaacaggaaaacactcgactacagagtatcgttgataaccagaag
tattcagtcgctgacattgagagaataaatcatgagaaaaatgaattgcagcagactatt
aataaattaaccaaagacctggaagccgaacagcaacagatgtggaatgaagaattaaaa
tacgcaagaggcaaagaggcgattgaagcgcagctagcggagtaccacaagttggctaga
aaattaaagcttatccccaaaggtgctgagaattccaaaggttacgactttgaaattaag
tttaatcctgaggcgggtgccaactgccttgtcaaatacaggactcaagtgtatgcaccg
ctcaaagagctcttgaatgaaagcgaagaagaaattaacaaagctctgaataaaaagagg
catctggaggatactttagaacaactgaacaccatgaaaacggaaagcaagaacactgtg
aggatgctgaaggaggagattcagaaactggatgaccttcaccagcaggcagtgaaggaa
gctgaggaaaaagacaagaagagtgccagtgagcttgagtccctggagaaacacaagcac
ctgctggagagcggggtgaacgatggcctcagcgaggccatggatgagttggacgccgtc
cagcgggaataccagctaactgtgaagaccacaactgaagaaagaagaaaggtggaaaac
aacttacaacgtcttttggagatggtcgccacacacgtagggtctttggagaaacatctt
gaagaggagaatgctaaagccgacagagagtatgaagaattcatgtctgaagatctcctg
gaaaacatcagggagatggcagagaagtataagagaaatgctgcccaacttaaggctccc
gacaaatga

DBGET integrated database retrieval system