KEGG   Mus musculus (mouse): 67057
Entry
67057             CDS       T01002                                 

Gene name
Yaf2, 2810021M11Rik
Definition
(RefSeq) YY1 associated factor 2
  KO
K11468  YY1-associated factor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67057 (Yaf2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     67057 (Yaf2)
Motif
Pfam: YAF2_RYBP zf-RanBP PROCN
Other DBs
NCBI-GeneID: 67057
NCBI-ProteinID: NP_077151
MGI: 1914307
Ensembl: ENSMUSG00000022634
Vega: OTTMUSG00000017284
UniProt: Q99LW6
Position
15; 15 E3
AA seq 179 aa
MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLV
AQQVTQQFVPPTQSKKEKKDRVEKDKSEKEAASKKNCHKKTRPRLKNVDRSSAQHLEVTV
GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGEASSLNGESH
NT seq 540 nt   +upstreamnt  +downstreamnt
atgggcgacaagaagagccccaccaggccgaagcggcagccgaagcccgcctcggatgag
ggctactgggactgcagtgtctgcaccttccggaacagcgccgaggccttcaagtgcatg
atgtgcgatgtgcggaagggcacctccacccggaagccacgccctgtctcccagctggtc
gcacagcaggtcacgcagcagttcgtgccccctacccagtcgaagaaagagaagaaagac
cgagtagagaaggacaagagtgagaaggaagctgctagcaaaaagaactgtcacaagaaa
accagaccaagattaaaaaatgtggatcggagtagcgctcagcatttggaagtcactgtt
ggagatctaacagtcattatcacagactttaaggagaaagccaagtcagcgcctgcgtcc
agcgctgctggcgatcagcacagccagggcagctgcagctcggacagcactgagcggggt
gtgtccaggtcctcctcgccgcggggagaagcctcctccctcaacggagagtctcactaa

DBGET integrated database retrieval system