KEGG   Mus musculus (house mouse): 67059
Entry
67059             CDS       T01002                                 
Symbol
Ola1, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, PTD004
Name
(RefSeq) Obg-like ATPase 1
  KO
K19788  obg-like ATPase 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67059 (Ola1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     67059 (Ola1)
SSDB
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS MeaB
Other DBs
NCBI-GeneID: 67059
NCBI-ProteinID: NP_080218
MGI: 1914309
Ensembl: ENSMUSG00000027108
UniProt: Q9CZ30
Position
2:complement(72923145..73044791)
AA seq 396 aa
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPILDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKDEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcccccgaaaaagggaggagatggaattaaaccgcctccaattattggaagatttgga
acctcactgaaaattggtatcgttggattgccaaatgttgggaagtctaccttcttcaat
gtattaaccaatagtcaggcttcagcagaaaacttcccattctgcactattgatcctaat
gagagcagagtgcctgtgccagatgagaggttcgactttctttgccagtaccataaacca
gcaagcaagattcctgctttcctaaatgtagtggatattgctggccttgtaaaaggagct
cacaatgggcagggcttggggaatgcctttttatctcatattagtgcctgtgatgggatt
tttcatctaacacgtgcttttgaagacgatgatatcacgcatgttgaaggaagtgtagat
cccatccgagacatagagataattcacgaggagctccagctgaaggacgaggagatgatt
gggcccattctagacaaactagagaaggtggccgtgaggggaggcgacaagaaactgaag
cccgagtatgacataatgtgcaaagtcaagtcttgggttatagatcaaaagaaacctgtt
cgcttctatcatgactggaatgacaaagagattgaagtgttgaataaacacttatttttg
acttcaaaaccaatggtctacttggtgaatctttctgaaaaagactatataagaaagaaa
aacaaatggttgataaaaattaaagagtgggtggacaagtatgacccaggcgccttggtc
attccttttagtggggccttggaactcaagttgcaagaattgagtgctgaggagagacag
aagtatctggaagcgaacatgacacaaagtgctttgccaaagatcattaaggctggattt
gcagcactccaactagaatactttttcactgcaggcccagatgaagtgcgtgcgtggacc
atcaggaaaggaacgaaggctcctcaggctgcaggaaagattcacacagatttcgaaaag
ggattcattatggctgaagtaatgaagtatgaagactttaaagacgagggttctgaaaac
gcagtcaaggctgctggaaaatacagacaacaaggcaggaattatattgttgaagatgga
gatattatcttcttcaaatttaatacacctcagcaaccaaaaaagaaataa

DBGET integrated database retrieval system