KEGG   Mus musculus (mouse): 67064Help
Entry
67064             CDS       T01002                                 

Gene name
Chmp1b, 2810405I11Rik, Chmp1b1
Definition
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04217  Necroptosis
Module
mmu_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    67064 (Chmp1b)
  09143 Cell growth and death
   04217 Necroptosis
    67064 (Chmp1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67064 (Chmp1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    67064 (Chmp1b)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    67064 (Chmp1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   67064 (Chmp1b)
  Exosomal proteins of other body fluids (saliva and urine)
   67064 (Chmp1b)
  Exosomal proteins of colorectal cancer cells
   67064 (Chmp1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Ist1 FlxA Mu-like_Pro Minor_capsid_3 DMSP_lyase Mt_ATP-synt_D DUF948
Motif
Other DBs
NCBI-GeneID: 67064
NCBI-ProteinID: NP_077152
MGI: 1914314
Ensembl: ENSMUSG00000109901
Vega: OTTMUSG00000060244
UniProt: Q99LU0
Position
18; 18 E1
AA seq 199 aa AA seqDB search
MSNMEKHLFNLKFAAKELNRSSKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QGVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKSMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatggagaagcatctgttcaacctgaaattcgcggccaaagaactgaaccgg
agttccaaaaaatgcgacaaggaagaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggattcacgccgaaaatgccatccgccagaagaat
caaggggtgaacttcttgagaatgagtgcacgagtggatgcggtggcggcccgtgtccag
actgcagtgacgatgggcaaagtgaccaagtccatggcgggtgtggttaagtcgatggac
gcgacgttgaaaagtatgaatctggagaagatctccgctttgatggacaaattcgaacac
cagttcgagactctggacgtccagacgcagcaaatggaagacacaatgagcagcacgacg
acgctgaccactccccagaaccaggtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgatctcaacatggagctgcctcagggccagaccggttccgtgggaacgagcgtg
gcttcggctgagcaagatgaactgtcccagagactggcccgccttcgggatcaagtctga

DBGET integrated database retrieval system