KEGG   Mus musculus (mouse): 67065Help
Entry
67065             CDS       T01002                                 

Gene name
Polr3d, 2810426M17Rik, 44kDa, AI326118, AW489084, BN51T, RPC4, TSBN51
Definition
(RefSeq) polymerase (RNA) III (DNA directed) polypeptide D
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67065 (Polr3d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    67065 (Polr3d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67065 (Polr3d)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     67065 (Polr3d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 67065
NCBI-ProteinID: NP_001157554
MGI: 1914315
Ensembl: ENSMUSG00000000776
UniProt: Q91WD1
Position
14; 14 D2
AA seq 398 aa AA seqDB search
MSEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQL
PLAHSGWLFKEESEEPEAKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAAR
KTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVV
IKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaggaaacgcggcgggcgagcccagcaatcctggagggccgcgaccccttctc
tctgggggccgggggctgatcggccggcggcccgcacccccgcttacgcccggtcgcctt
ccctccatccgctcccgggacctcacccttggcggagtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaagaagagccaaaagaagaagtgactatgaagaaggaa
aagcgtgaacgggacagggaccgccagcgtgagggtcacggacggggacgtggccgcccg
gaagtgatccagtcccattctatcttcgagcagggtccggcagaaatgatgaaaaaaaaa
gggaactgggataagaccgtggacatgtccgacatgggaccttctcatatcatcaacatc
aaaaaagagaagagagaaacagacgaagagaccaagcagatcctgcgcatgctggagaag
gatgacttcatcgatgacccggggctaaagaatgacacacggaacatgccagtgcagctg
cctctggctcattcagggtggctttttaaggaggagagtgaagagccagaggctaagcct
ttttcggctggccccaaggaagaagatatggaggtggacgtgcctgccgtcaaagtgaaa
gaggagccacgagatgaggaagaggaagccaaggtgaaagcccctccaagagcagcccgg
aagactcctggcctcccaaaggacgtgtcggtggccgagctgctcagagagctgagcctc
atgaaggatgaggagctcctgttccttcagctgcctgacaccctccccgggcagccaccc
actcaggacatcaagcctgtcaagacagaggtgcagggcgaggatggacagatggtagtc
ataaagcaggaaaaagaccgggaagccaggctagcagagaatgcttgtaccttggctgac
ctgacagagggtcaagtgggcaaactgctcatccgtaagtcagggaaggtgcaactcctc
ctgggcaaggtgactctagatgtgaccatgggaacgacctgttctttcctgcaggaactg
gtgtctgtgggccttggagacagcagaacaggggagatgacagtcctgggacatgtgaag
cacaaacttgtatgttctcctgattttgaatctctcttggatcacaaacaccggtga

DBGET integrated database retrieval system