KEGG   Mus musculus (mouse): 67067Help
Entry
67067             CDS       T01002                                 

Gene name
Romo1, 2010100O12Rik, AI853864
Definition
(RefSeq) reactive oxygen species modulator 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Romo1 Tim17 TCRP1
Motif
Other DBs
NCBI-GeneID: 67067
NCBI-ProteinID: NP_001157688
MGI: 1914317
Ensembl: ENSMUSG00000067847
Vega: OTTMUSG00000016121
UniProt: P60603
Position
2; 2 H1
AA seq 79 aa AA seqDB search
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggccgtgggtccctacgggcagtcccagcccagctgcttcgaccgcgtgaag
atgggcttcgtcatgggttgcgcagtgggtatggcggccggggcgctgttcggcaccttc
tcctgtctcaggatcggaatgcggggtcgggagctaatgggcggcattgggaaaaccatg
atgcagagtggcggcacgtttggcactttcatggccattggaatgggcatacgatgctaa

DBGET integrated database retrieval system