KEGG   Mus musculus (mouse): 67071
Entry
67071             CDS       T01002                                 

Gene name
Rps6ka6, 2610524K04Rik, RS, RSK4, S6K-alpha-6
Definition
(RefSeq) ribosomal protein S6 kinase polypeptide 6
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04114  Oocyte meiosis
mmu04150  mTOR signaling pathway
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04931  Insulin resistance
mmu05135  Yersinia infection
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    67071 (Rps6ka6)
   04150 mTOR signaling pathway
    67071 (Rps6ka6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    67071 (Rps6ka6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    67071 (Rps6ka6)
  09156 Nervous system
   04720 Long-term potentiation
    67071 (Rps6ka6)
   04722 Neurotrophin signaling pathway
    67071 (Rps6ka6)
  09159 Environmental adaptation
   04714 Thermogenesis
    67071 (Rps6ka6)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    67071 (Rps6ka6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    67071 (Rps6ka6)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    67071 (Rps6ka6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    67071 (Rps6ka6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67071 (Rps6ka6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     67071 (Rps6ka6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   67071 (Rps6ka6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     67071 (Rps6ka6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 67071
NCBI-ProteinID: NP_080225
MGI: 1914321
Ensembl: ENSMUSG00000025665
Vega: OTTMUSG00000018383
UniProt: Q7TPS0 E9QK39
Position
X; X E1
AA seq 860 aa
MLNFRRTRHTPSGHRSNSNLNLFCCLPFFGCRRRSKSRQRAGTPVVPLLRYPRLARSAVT
QRETWSFEDDQEPAQQTGCMLVLGPGSFFSRAPEAAMLPFAPVEDPWDQEDMEVFGSTSS
SEPQVVFTMKNAATVMREHERKEVNDLKMVDEPMEEGEPVSCRREELVKEIPITQHVKEG
YEKADPAQFDLLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRVRTKMER
DILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELAL
ALDHLHRLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEV
VNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSLL
RMLFKRNPANRLGSEGVEEVKRHAFFASIDWNKLYKREVQPPFRPASGKPDDTFCFDPEF
TAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPVTSSNVLPIVQINGNAAQFSE
AYELKEDIGIGSYSVCKRCIHSASNVEFAVKIIDKNKRDPSEEIEILMRYGQHPNIISLK
EVFDDGKYVYLVTDLMKGGELLDRILKKKCFSEQEASNVLYVITKTVECLHSQGVVHRDL
KPSNILYMDESAHPDSIKICDFGFAKQLRGENGLLLTPCYTANFVAPEVLTQQGYDAACD
IWSLGVLLYTMLAGYTPFSNGPNDTPEEILLRIGNGRFSLSGGIWDNISRGAKDLLSHML
HMDPHQRYTAEQVLKHPWITQREQLPRHQPNSDEPPQEAVAAPYSVLARNPNRHHPILEP
VTASRLAQRRNMKKRTSTGL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgctgaattttagaaggacacgccacacgccatctggccacaggtccaactctaacttg
aacctgttctgttgtcttccattttttggatgtcgtcggcgatccaagagtcggcagcgg
gcggggacccccgtggtccctcttttgaggtacccgcggctggcgaggtcggcagtcacc
cagcgcgagacctggtccttcgaagacgaccaggagcccgctcagcagacgggatgcatg
ctggtgctggggccaggcagcttcttctcgagagcccctgaagcggcgatgctaccgttc
gcccctgtggaggatccctgggaccaagaagacatggaggtgttcggcagcacgagcagt
agcgagccacaggttgtgtttaccatgaagaacgcagcaacggttatgcgggagcatgaa
cgcaaagaggtaaatgatctgaaaatggttgatgagccaatggaagagggagagccagtt
tcttgccggcgggaagaattggttaaggagatacctattacacagcatgttaaagaagga
tacgagaaagcagatcccgcacagtttgacttgctcaaggttcttggtcagggatctttt
ggaaaggtttttcttgttagaaagaagactggtcctgatgctgggcagctctatgcaatg
aaggtgttaagaaaagcttctttgaaagttcgagaccgagttcgcacaaagatggagagg
gatatcttggtggaagtaaatcatccctttatcgtcaaactgcactatgcttttcagact
gaagggaagctgtacttaatattggatttcctcaggggaggagatgtcttcacaagatta
tccaaagaggttctttttacagaggaagatgtgaaattctaccttgcagaattggccctg
gctttggatcatctacatcgattaggaattgtttatagagacctgaaaccagaaaacatc
ttacttgatgaaataggacatatcaagttaacagattttgggcttagcaaagagtcagtg
gatcaagaaaagaaggcctactcattttgtggtactgtagaatatatggcccctgaagta
gtaaacagacgaggccattctcagagtgctgattggtggtcatatggtgtacttatgttt
gaaatgcttactggcactttgccatttcaagggaaagacagaaatgagaccatgaatatg
atactgaaagcaaaacttggaatgccccaattccttagtgctgaagcacaaagtctatta
aggatgttattcaaaaggaatccagcaaatagattggggtcagaaggagttgaagaagtc
aaaagacatgctttttttgcttccattgactggaataaactatataaaagagaagtccag
cctcctttcagacctgcttctggaaaaccggatgataccttctgttttgatcctgaattt
actgccaaaacacctaaagattctcctggtttgccagccagtgcaaacgctcatcaactc
ttcaaaggattcagttttgttgcgacttctattgccgaagaatataaaatcactcctgtt
acaagttcaaatgtattaccaatcgttcagataaatggaaatgctgctcaatttagtgaa
gcttatgaattgaaagaggatattggtattggttcttattctgtttgcaagcgatgcata
cactcagcttccaatgtggaatttgcagtcaagatcattgataaaaataagagagacccc
tcagaagaaattgaaattttgatgcgctatggacaacatcccaacattatctctttaaag
gaggtctttgatgatgggaaatatgtttaccttgttacggacttgatgaaaggaggagaa
cttctggatcggattctcaaaaagaaatgtttctcagagcaggaagctagtaatgtgctg
tatgtaataaccaagacagttgaatgccttcattctcaaggagtcgttcatcgtgatctt
aagcccagtaatattttatatatggatgagtcagcccatccagattcaatcaagatctgt
gattttgggtttgcaaaacagcttcgtggagaaaatggacttctgttaactccgtgctac
accgcaaactttgtagcacctgaggttctcactcaacagggatatgatgctgcctgtgat
atttggagcttaggagtccttttgtacacaatgttggctggctacactccattttccaac
ggccccaatgatactcctgaggaaatactgctgcgcataggcaacgggaggttctctttg
agtggtggaatctgggacaatatttcacgtggagcaaaggatttgctttctcatatgctt
cacatggacccacatcagcgttatactgctgagcaagtattaaagcacccttggataacc
caaagagaacaactgccgcgccatcagccaaactcagatgagccaccacaggaagcagtg
gcagcaccatattctgtcttggctcggaacccaaacaggcatcatccaatcctggagcct
gttactgcttcacgtttagctcagaggcggaacatgaaaaagcgaacatcaactggcttg
taa

DBGET integrated database retrieval system