KEGG   Mus musculus (mouse): 67075Help
Entry
67075             CDS       T01002                                 

Gene name
Magt1, 2410001C15Rik, 2610529C04Rik, 2810482I07Rik, IAG2, IAP
Definition
(RefSeq) magnesium transporter 1
  KO
K19478  magnesium transporter 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67075 (Magt1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC58: MagT-like magnesium transporter
   67075 (Magt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OST3_OST6 Thioredoxin DUF4131
Motif
Other DBs
NCBI-GeneID: 67075
NCBI-ProteinID: NP_001177338
MGI: 1914325
Ensembl: ENSMUSG00000031232
Vega: OTTMUSG00000018276
UniProt: Q9CQY5 A2ADH1
Position
X; X D
AA seq 335 aa AA seqDB search
MASPRWFWSVCAIAAVALLLVSKVPSASAQRKKEMVLSEKVSQLMEWANKRPVIRMNGDK
FRRLVKAPPRNYSVVVMFTALQLHRQCVVCKQADEEFQILANSWRYSNAFTNRIFFAMVD
FDEGSDVFQMLNMNSAPTFINFPPKGKPKRADTYELQVRGFSAEQIARWIADRTDVNIRV
IRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRR
MMCIAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccaaggtggttctggtctgtgtgtgcgatcgcagcggtggcactgctgctc
gtttccaaggttccttcggcctctgcccaaagaaagaaggagatggtgttatctgagaag
gttagtcagctgatggaatgggccaataagagacctgtaataagaatgaatggagacaag
ttccgtcgtcttgttaaagctccaccgagaaattactcagttgtcgtcatgtttactgct
ctccaacttcatagacaatgtgtcgtttgcaagcaagctgatgaagaattccagattttg
gcaaattcttggcgatactccaatgcatttaccaacaggatattttttgccatggtggat
tttgatgaaggctcagatgtatttcaaatgctaaacatgaattcagctccaactttcatc
aactttcctccgaaaggaaaacccaaaagggctgatacatatgagttgcaggtgcgaggg
ttttcagctgagcagattgcccggtggattgcagacagaactgatgtcaacattagagta
attagacctccaaattatgctggacccctaatgttgggactgctgctggctgttattggt
ggacttgtgtatctgcgaagaagcaatatggagttcctctttaataaaactggatgggct
tttgcagctttgtgttttgtacttgctatgacatctggccaaatgtggaaccatataaga
ggaccaccatatgctcataaaaatccccacacaggacacgtgaattacatccacgggagc
agccaggcccagtttgtagctgaaacccacatcgttcttctattcaatggtggggttacc
ttaggaatggtgcttttatgtgaagctgctacctctgacatggatattgggaagcgaagg
atgatgtgtattgctgggattggactcgttgtgttattcttcagttggatgctctctatc
tttcgatcaaaataccatggctatccatacagctttctgatgagttaa

DBGET integrated database retrieval system