KEGG   Mus musculus (mouse): 67088
Entry
67088             CDS       T01002                                 

Symbol
Cand2, 2210404G23Rik, Tp120b, mKIAA0667
Name
(RefSeq) cullin-associated and neddylation-dissociated 2 (putative)
  KO
K24172  cullin-associated NEDD8-dissociated protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67088 (Cand2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    67088 (Cand2)
SSDB
Motif
Pfam: TIP120 HEAT_2 HEAT HEAT_EZ Adaptin_N Cnd1 MMS19_C CLASP_N Dopey_N
Other DBs
NCBI-GeneID: 67088
NCBI-ProteinID: NP_080234
MGI: 1914338
Ensembl: ENSMUSG00000030319
Vega: OTTMUSG00000023297
UniProt: Q6ZQ73
Position
6; 6 E3
AA seq 1235 aa
MSTGAFYISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVRTLLRLLEDR
SGEVQNLAVKCLGPLVGKVKEYQVENIVDTLCANMRSDKEQLRDIAGIGLKTVLSELPPA
ATGSGLAINVCRKITGQLTSAIAQQEDVAVQLEALDILSDMLSRLGAPLGTFHASLLHCL
LPQLSSPRLAVRKRTVVALGHLAAACSTDLFVELADHLVDRLPGPRAPASPAAIRTLIQC
LGSVGRQAGHRLGAHLDRLVPMVEEFCNLDDDELRESCLQAFEAFLRKCPKEMDPHVPNV
TSLCLQYMKHDPNYDHDSDDEEQMETEDSEFSEQESEDEYSDDDDMSWKVRRAAAKCMAA
LISSRPDLLPDFHCTLAPALIRRFKEREENVKADIFGAYIMLLRHTRPPKGWLEAVEEPT
QTGRNLNMLRAQVPLVIKALQRQLKDRNVRTRQGCFNLFTELAGVLPGSLAEHMAVLVSG
IVFSLADYSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPTLLPPVMACVADPFYKVAAEA
LLVLQELVRTLWPLDRPRLLDPEPYVGEMSTATLARLRATDLDQEVKERAISCVGHLVGH
LGDRLGDDLEPTLMLLLDRLRNEITRLPAVKALTLVAMSPLRLDLQPILAEALPILASFL
RKNQRALRLATLAALDALAQSQGLGLPPPAVRTVLTELPALVSENDMHVAQLAVDFLTTV
TQTQPSSLVEVSGPVLGELLQLLHSPLLPAGVLAATEGFLQALVGTRPPCVEYSELISLL
TAPVYNQVGDGGPGLHKQVFHSLARCVAALSAACPQEAAGTASRLVCDAKSPHSSTGVKV
LAFLSLAEVGQVAGPGPQRELKTVLLEALGSPSEDVRAAAAYALGRVGAGNLPDFLPFLL
AQIEAQPRRQYLLLHALREALGAAQPDNLKPYVEDVWALLFQRCESPEEGTRCVVAECIG
KLVFVNPPYLLPRFRKQLAAGQPYTRSTVITAVKFLISDQPHSIDPLLKSFIAEFMESLQ
DPDLNVRRATLTFFNSAVHNKPSLVRDLLDDILPLLYQETKIRRDLIREVEMGPFKHTVD
DGLDVRKAAFECMYSLLESCLGQLDMCEFLNHVEDGLKDHYDIRMLTFIMLARLATLCPA
PVLQRVDRLIEPLRATCTAKVKAGSVKQELEKQEELKRSAMRAVAALLTNPEVRKSPTVA
DFSAQIRSNPELTTLFESIQKDTASGPSTDSMELS
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgagtaccggtgccttctacatctccagcctgctggagaagatgacgtccagcgacaaa
gacttcaggttcatggctaccagtgacctgatgtcagagttgcagaaagactccatccag
ctggatgaggacagcgagcgtaaggtggtgaggacgctcctgcggctcctggaggacagg
agtggtgaggtgcagaacctggctgtcaagtgcctgggtcccctggtgggcaaggtgaag
gagtaccaagtggagaacattgtggacaccctctgtgccaacatgcggtcagacaaggag
cagctccgggacatcgctggcattggcctgaagaccgtgctttcagagctgcctcccgcc
gccacaggctcagggctggctatcaatgtgtgtcgaaagatcacaggccaactcaccagt
gccatcgcccagcaggaggatgtggctgtgcagctggaagccctggacatcctctctgac
atgctgagcaggctaggtgccccgttgggcaccttccatgcaagcctgctgcactgccta
ttgccccagctgagcagcccacgcctggctgtgcgcaagcgcactgttgtcgcacttggt
catctggcagccgcctgcagcactgacctcttcgtggagcttgctgaccacctggtggac
cggctgcctgggccacgggcacccgccagccctgcagccattcgaaccctgatccagtgc
ttgggcagcgtgggccgtcaggcaggccatcgcctgggggcccacctggaccgcctggtg
cccatggtggaggagttctgcaacctggatgacgatgagctaagagagtcctgcctccag
gcctttgaggccttcctaagaaagtgccccaaggagatggaccctcacgtacccaatgtg
accagcctctgcctgcagtacatgaagcatgaccccaactatgaccatgacagtgatgac
gaagagcagatggagaccgaggacagtgaattcagtgagcaagagagtgaggacgagtac
agtgatgatgacgacatgagctggaaggtacgccgagctgcggccaagtgcatggcagcc
ctcatcagctctcggcccgacctcctgcccgacttccactgcactctggcacctgcgctc
atccgccgcttcaaggagcgggaggagaacgtcaaggcagacatcttcggggcttacatc
atgttgctgcgacatacacggccccctaaaggctggttggaggctgtggaggagcccacc
cagactggcagaaacctcaatatgctgcgagcacaggtgcccctagtgataaaggccctg
cagcgacaacttaaagaccggaatgttcggacccgccaaggctgcttcaacctcttcacc
gagctggcaggcgtcctccctggcagcctggcagagcacatggctgtgttggtgtcaggc
attgtcttttcactggccgactactcaagctcctccaccattcggatggatgccctggcc
ttcctgcagggacttctgggtacagagccggctgaggccttccatccccacttgcctacc
ctcctaccacctgtgatggcctgtgtggctgaccctttctacaaggtggcagctgaggcc
ttactggtgctccaggagctggtgcggaccctgtggccactggataggcctcggctgctg
gaccctgaaccatatgtcggagagatgtccacagctaccctggcacgactccgagccact
gacctggaccaggaggtgaaggaacgggccatctcttgtgtgggccaccttgtgggtcac
cttggtgatcgacttggggacgacctagaacccacacttatgcttctcctggatcgccta
cggaatgagatcacccggttgcctgctgtcaaggcactgaccctggtggccatgtcccca
ttgcgacttgacctgcagcccatcctggctgaggccctgcccatcctggcttcatttctg
cgcaagaatcagcgggccctgcggctggccacactggctgctctggatgccctggctcag
agccagggcctcggcctgcccccgcctgccgtgcggactgtgctaaccgagctgcctgct
ctggtcagcgagaatgacatgcatgtggcccagctggctgtcgacttcctcaccacagtg
acccagacgcagcccagctctctggttgaggtcagtggccccgttctgggggagctgctg
cagctgctgcactcacccttgctgcctgccggggtgttggcagccactgaaggcttcctg
caggcgctggtgggaacccgccctccgtgtgtggagtactcggagctcattagcctgctc
actgcacctgtttacaaccaggttggggacgggggacccggcctgcacaagcaggtgttc
cactcgctggcccggtgtgtagctgccctctcagctgcctgcccccaggaggccgcaggt
actgccagccgcctggtttgtgatgccaagtcgccccactcaagcacgggggtcaaagtc
ttggcattcctgtcactggctgaggtgggccaggtggcagggccaggcccccagagggag
ctgaagaccgtgcttctggaagccctggggtctcccagtgaggacgtgagggctgcagcc
gcatatgccctgggccgtgtgggtgctggcaacctgcctgacttcctgcccttcctgctg
gcacaaattgaggcccagccccggcgacagtacctgctgctacatgcactcagggaggcc
ctgggggctgcgcagcctgacaatctgaagccctatgttgaggatgtgtgggcgctgctc
ttccagcgctgtgagagccccgaggaaggcactcggtgtgtggtggcggagtgcatcggg
aagctagtgtttgtgaaccctccctacctcctgcctcgattccggaagcagctcgctgca
ggtcagccatacacccggagcacggtcatcactgcagtcaagttcctcatctcagaccag
cctcactccatcgaccctctcctgaagagcttcattgcggagttcatggaaagcctgcag
gacccagacctgaacgtgcgccgggccacactcaccttcttcaactcagctgtgcacaac
aaaccatcactggtccgggacctgttggatgacatcctgcccctcctctaccaggagacc
aagatccgccgggacctcatccgagaggtggagatggggcccttcaagcatactgtggat
gatgggctggatgtgaggaaggctgccttcgagtgcatgtactcgctgctggagagctgc
ctgggccagctggacatgtgcgagtttctgaaccacgtggaggatgggctgaaggaccat
tatgacatccggatgctgaccttcatcatgttggcccgactggccactctttgtcctgca
cctgtcctgcagagggtggaccggctcatcgagccactcagagccacctgtactgccaag
gtcaaggctggttctgtgaagcaggagctggagaagcaggaggagctgaagcgctcagca
atgcgggcagtggccgccctgctgaccaaccctgaggtgcgcaagagccccactgtagct
gacttttccgcccagatccgatccaacccagaactcaccaccctcttcgagagcatccaa
aaggacacagcctccggccccagcacggactctatggaactcagctag

DBGET integrated database retrieval system