KEGG   Mus musculus (house mouse): 67106
Entry
67106             CDS       T01002                                 
Symbol
Zbtb8os, 2010001H09Rik, 2310028N13Rik, AI851226, Arch, Archm
Name
(RefSeq) zinc finger and BTB domain containing 8 opposite strand
  KO
K24956  protein archease
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    67106 (Zbtb8os)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligase complex
    67106 (Zbtb8os)
SSDB
Motif
Pfam: Archease
Other DBs
NCBI-GeneID: 67106
NCBI-ProteinID: NP_080246
MGI: 1914356
Ensembl: ENSMUSG00000057572
UniProt: Q505B7 B2KGA7
Position
4:129229325..129243664
AA seq 167 aa
MAQEEEDVRDYNLTEEQKATKDKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAM
FGYMTDTGTVEPLRTVEVETQGDDLQSLLFHFLDEWLYKFSADEYFIPREVKVLNIDQKN
FKLRSIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEEKPEVFVIIDI
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctcaagaggaggaagatgttagagattacaatttgacggaggaacagaaggcgacc
aaggacaagtatcctccagtcaatcgaaaatatgaatatttggatcatacggctgatgtc
cagttacacgcatggggagacactctggaggaagcatttgaacagtgtgccatggccatg
tttggttacatgacagatactgggactgtggagcccctccgcaccgtggaagtagaaacc
caaggggacgacctgcagtctctgctgtttcactttttggacgagtggctttacaagttc
agcgctgatgagtacttcataccccgggaagtgaaagtacttaatattgatcagaaaaat
ttcaagttacgatccattgggtggggagaagagttctcactgtccaagcaccctcaggga
acagaagtcaaggcaataacgtactcagcaatgcaagtctataatgaagagaagccagaa
gtgtttgtgatcatcgacatttaa

DBGET integrated database retrieval system