KEGG   Mus musculus (mouse): 67111
Entry
67111             CDS       T01002                                 

Gene name
Naaa, 2210023K21Rik, 3830414F09Rik, A, Asahl
Definition
(RefSeq) N-acylethanolamine acid amidase
  KO
K13720  N-acylethanolamine-hydrolysing acid amidase [EC:3.5.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    67111 (Naaa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     67111 (Naaa)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C89
   67111 (Naaa)
SSDB
Motif
Pfam: NAAA-beta CBAH
Other DBs
NCBI-GeneID: 67111
NCBI-ProteinID: NP_080248
MGI: 1914361
Ensembl: ENSMUSG00000029413
Vega: OTTMUSG00000024987
UniProt: Q9D7V9 Q3V023
Structure
PDB: 
6DXY

Position
5; 5 E2
AA seq 362 aa
MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSLDAAPEQRWLPMLRHY
DPDFLRTAVAQVIGDRVPQWVLGMVGEIVSKVESFLPQPFTDEIRSICDSLNLSLADGIL
VNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQFIKNGQIAFTGTTFV
GYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLSESESFEAAVY
TLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLNGEWFRVETNYDHWKPAP
KVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIYTTVMSAAEPDKYLTMIRN
PS
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggaccctagccaccagggccgcgtgccatggggcacacctggccctggctctgttg
ctgctactgtcgctgtccggtccctggctgtcggctgtcgtccccgggactccgcctctc
ttcaacgtcagtctggacgcggccccggagcagcgctggctgccgatgctgcggcactac
gacccagacttcttgcgcaccgcggtggcgcaggtcattggcgacagggttccccagtgg
gtactcgggatggtcggagaaattgtgtcgaaggtggagagcttcctgcctcagcccttc
accgacgagatccgcagcatctgtgactcgctcaacctcagcctggctgacggtatcttg
gtcaacctggcctacgaggcttccgcattctgcaccagtattgtggcccaagactcccaa
ggccatatttaccacggccggaacctggactatccttttggaaaaatcttacgaaagctg
acagcgaacgtgcagtttataaagaatgggcagattgcattcactgggaccacttttgtt
ggctatgtaggactgtggacaggccaaagtccacacaagtttacaatttctggtgatgaa
cgagataaaggctggtggtgggagaatatgatcgcggcgctttctctgggacactccccc
atcagctggcttatccgcaaaaccctgagtgagtcagaaagcttcgaagcagctgtctac
acgctggccaagactcccctcattgctgacgtttattacattgttgggggtacatcgccc
aaggagggagtagtcatcaccagggaccgaggtggcccggcagacatttggcctcttgac
cctctgaatggagagtggttccgagttgagacaaattatgaccattggaagcctgcaccc
aaggtggatgaccgaagaacaccagccatcaaagccctaaatgctacagggcaagctcac
ctcaatctggagaccctcttccaggttttatccctgtttcctgtttataacaactacaca
atttatactacagtgatgagcgctgccgagcccgacaagtacctgaccatgatcagaaac
ccgagctga

DBGET integrated database retrieval system