KEGG   Mus musculus (mouse): 67117
Entry
67117             CDS       T01002                                 

Symbol
Dynlt3, 2310075M16Rik, AU042796, Tcte1, Tcte1l
Name
(RefSeq) dynein light chain Tctex-type 3
  KO
K10420  dynein light chain Tctex-type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    67117 (Dynlt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67117 (Dynlt3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     67117 (Dynlt3)
SSDB
Motif
Pfam: Tctex-1
Other DBs
NCBI-GeneID: 67117
NCBI-ProteinID: NP_080251
MGI: 1914367
Ensembl: ENSMUSG00000031176
Vega: OTTMUSG00000016890
UniProt: P56387 Q542J7
Position
X; X A1.1
AA seq 116 aa
MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGK
AYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL
NT seq 351 nt   +upstreamnt  +downstreamnt
atggaggggtaccaacggccctgcgatgaggttggcttcaatgctgatgaagcccataat
atagtcaaagagtgtgttgatggagttttgggtggtaacgattataatgagaataacatc
aaccaatggactgcaagcatagtggaacagtctataacacatttggtcaaactggggaaa
gcttacaagtacattgtgacctgtgcagtggtccagaggagcccgtatggatttcacaca
gccagctcctgtttttgggatacaacatctgatggaacctgtaccatcagatgggagaac
cgtaccatgaactgcatcgtgaatgtttttgcagttgcgattgtcctgtag

DBGET integrated database retrieval system