KEGG   Mus musculus (mouse): 67123
Entry
67123             CDS       T01002                                 

Symbol
Ubap1, 2700092A01Rik, NAG20, UBAP-1, Ubap
Name
(RefSeq) ubiquitin-associated protein 1
  KO
K24629  ubiquitin-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67123 (Ubap1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    67123 (Ubap1)
SSDB
Motif
Pfam: UBA MerR-DNA-bind DUF2203
Other DBs
NCBI-GeneID: 67123
NCBI-ProteinID: NP_075794
MGI: 2149543
Ensembl: ENSMUSG00000028437
Vega: OTTMUSG00000006663
UniProt: Q8BH48
Position
4:41348996..41389766
AA seq 502 aa
MASKKLGTDVHGTFSYLDDVPFKIGDKFKTPAKVGLPIGFSLPDCLQVVREMQYDFSLEK
KTIEWAEDIKLIQEAQREAERKAEEAEAKVNSKSGPEGDSKVSFPKTHNTATMPPPINPI
LASLQHNNILTPTRVSSSATKQKVLSPPHTKADFNPADFECEEDPFDNLELKTIDEKEEL
RNILVGTTGPIMAQLLDSNTARGSSGAVLQDEEVLASLEQATLDFKPLHKPNGFITLPQL
GNCEKMSLSSKVSLPPIPTVSNIKSLSFPKLDSDDSNQKTVKLASTFHSTSCLRSGASRS
LLKPSTQSSASELNGDHTLGLSALNLNSGTEVPTLTSSQMPSLSSVSVCTEESSPPDPCP
TVTPLNFSVSQVPNMPSCPQAYLELQALSPSERQCVETVVNMGYSYDCVLRAMRKKGENI
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEV
LLLHNNDQDNALEDLMARAGAS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcttctaagaagttggggacagatgttcatgggactttcagttaccttgacgatgtc
ccatttaagataggagacaaattcaaaacaccagcgaaagtgggtctgcctattggcttc
tccttgcctgactgcttacaggttgtcagagagatgcagtatgacttctccttggaaaag
aaaaccattgagtgggctgaagatattaaactaatccaagaagctcagcgggaagcagag
cggaaggccgaggaagcagaagctaaagtgaattccaagagtggtccagagggtgacagc
aaagtgagcttccccaagactcacaatacagccacaatgccacctcctattaaccccatc
cttgccagcttacagcacaacaacatcctcactccaactcgggtcagcagtagtgccaca
aagcagaaagttctcagcccaccccacacaaaggcagacttcaatcctgctgacttcgag
tgtgaagaggacccatttgataatctggagttaaaaaccattgatgagaaggaagagctg
agaaacattctggtaggaaccactggacccataatggctcagttactggacagtaacaca
gcccggggaagctcgggggctgtgttacaggatgaggaggtcttggcatccttggagcag
gcaaccttagacttcaagcctcttcataaacccaatggctttataaccttaccacagttg
ggcaactgtgaaaagatgtcgctgtcttccaaagtgtccctcccccctattcctacagta
agcaatatcaaatctctctccttccccaaacttgactctgatgacagcaatcagaagaca
gtcaagcttgcgagcactttccatagcacatcctgcctccgaagtggcgcatcccggagt
ctcctaaagccttccacccaaagcagtgccagtgagctcaatggggaccacactcttggg
ctttcagctttgaacttgaacagtggcacagaggtgccaacactgacatcctcccagatg
ccttccctgtctagcgtgtctgtgtgtacagaagaatcatcacctccagatccatgtccc
acagtaacccctctaaatttctcagtgtcacaagtgcccaacatgcctagctgtccccag
gcctatttggaactgcaggcactgtctccgagtgagcggcaatgtgtagagacagtagtc
aacatgggctactcatatgattgtgtcctgagagccatgagaaagaaaggagagaatatt
gagcagattctcgactatctctttgcacacggacagctttgtgagaagggttttgaccct
cttttagtggaagaggctctggaaatgcaccagtgttcagaagaaaagatgatggagttt
cttcagttaatgagcaaatttaaggaaatgggctttgaactgaaagacattaaggaagtt
ttgctattacacaacaatgaccaggacaatgctctggaagacctcatggcccgggctgga
gccagctga

DBGET integrated database retrieval system