KEGG   Mus musculus (mouse): 67125
Entry
67125             CDS       T01002                                 

Gene name
Tspan31, 2700085A14Rik, AW742554, Sas, Tsp
Definition
(RefSeq) tetraspanin 31
  KO
K17356  tetraspanin-13/31
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    67125 (Tspan31)
SSDB
Motif
Pfam: Tetraspanin YrzO PHO4 Ac76
Other DBs
NCBI-GeneID: 67125
NCBI-ProteinID: NP_080258
MGI: 1914375
Ensembl: ENSMUSG00000006736
UniProt: Q9CQ88
Position
10; 10 D3
AA seq 210 aa
MVCGGFACSRNALCALNVVYMLVGFLLIGVAAWGKGLGVVSSIHIIGGVIAVGVFLLLIA
VAGLVGAANHHQVLLFFYMIILGLVFIFQFGISCSCLAINRNTQADVINASWSVLSNSTR
HELERSFDCCGLFNLTTLRLQDDTSCSAVCKTKSSTCQMCGERFLKHSDKALKILGGVGL
FFSFTEILGVWLAMRFRNQKDPRANPSAFL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggtttgcggcggatttgcctgttccaggaatgcgctgtgcgctctcaacgtggtttat
atgcttgtgggctttttgctcattggcgtggctgcctggggcaagggcctcggtgtggtg
tctagcattcacatcattggaggagtcattgctgtgggagtcttccttctcctcatcgcg
gtggcaggactggtgggcgccgcgaaccaccatcaagtgctgctcttcttttatatgatc
atcctaggtttggtcttcatcttccagtttggaatctcttgctcatgtctggctattaac
agaaacacacaggcagatgtcatcaatgcttcgtggtcggtcttgagcaacagtacccgg
catgaactggagagaagttttgactgctgtggcttgttcaaccttacaaccctgcgccta
caagatgatacttcctgtagtgcggtgtgcaaaactaagagctctacatgccagatgtgt
ggggagaggttccttaaacattcagacaaagccctcaagatcctaggaggtgttgggctc
ttctttagtttcacagagatccttggtgtttggctagcaatgagattccggaatcaaaag
gaccctcgagccaaccccagtgccttcctatga

DBGET integrated database retrieval system