KEGG   Mus musculus (mouse): 67139
Entry
67139             CDS       T01002                                 

Gene name
Mis12, 2510025F08Rik, AU044651, Misc12
Definition
(RefSeq) MIS12 kinetochore complex component
  KO
K11543  kinetochore-associated protein MIS12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67139 (Mis12)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      67139 (Mis12)
SSDB
Motif
Pfam: Mis12 Caps_synth_GfcC 60KD_IMP MerR-DNA-bind DUF5082
Other DBs
NCBI-GeneID: 67139
NCBI-ProteinID: NP_080269
MGI: 1914389
Ensembl: ENSMUSG00000040599
Vega: OTTMUSG00000006078
UniProt: Q9CY25
Position
11; 11 B4
AA seq 206 aa
MSVDPMAYEAQFFGFTPQTCLLRIYVAFQDHLFEVMQAVEQVILKKLEDIPNCEITPVQT
RKCTEKFLCFMKGRFDNLFGKMEQLILQSILCIPPNILLPEDKCQETNPFSEEKLELLQQ
EIKELQEKYKVELCTEQALLAELEEQKTVKAKLRETLTFFDELENIGRYQGTSNFRESLA
SLVQSCRKLQSIRDNVEKESRRLETQ
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtctgtggatccgatggcctatgaggcccagttctttggcttcacaccacagacttgc
ctgctgaggatctacgtagcatttcaagaccacctgtttgaagtgatgcaggctgttgaa
caggttatcctaaagaagctggaggacattccaaactgtgagatcacccctgtccagact
cggaaatgcacagagaagtttctttgcttcatgaaaggacgcttcgataacctttttggc
aaaatggagcagctgattttgcagtcgattttgtgtattcctccaaacatcctgcttcct
gaagacaagtgtcaggagacgaatcctttcagtgaagagaaactcgagcttctccaacag
gaaatcaaagagttacaggagaaatacaaggttgagttgtgcactgagcaggcccttctt
gcagaattagaggagcagaaaactgttaaggccaaactcagagagaccttgactttcttt
gatgagcttgaaaacatcggcagatatcaaggaactagtaactttagggagagtttggca
tccctggtccagagctgcagaaaacttcagagcattagagacaatgtagaaaaagaaagc
aggagactggaaacacagtga

DBGET integrated database retrieval system