KEGG   Mus musculus (mouse): 67141Help
Entry
67141             CDS       T01002                                 

Gene name
Fbxo5, 2510044I10Rik, C85305, Emi1, Fbxo31
Definition
(RefSeq) F-box protein 5
  KO
K10292  F-box protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    67141 (Fbxo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67141 (Fbxo5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    67141 (Fbxo5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     67141 (Fbxo5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    67141 (Fbxo5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box IBR F-box-like
Motif
Other DBs
NCBI-GeneID: 67141
NCBI-ProteinID: NP_080271
MGI: 1914391
Ensembl: ENSMUSG00000019773
Vega: OTTMUSG00000022756
UniProt: Q7TSG3
Position
10; 10 A1
AA seq 421 aa AA seqDB search
MSRRTCSDLRRPSSCPCRLGARTTVDGCKEESPVLSVTMKCFNCNPDLSELEVVKPEDSG
IEASYSPVCLEPSCNDCVRNHERLSFIDSPIVGHDNKENQRVQNTLDSSNETEELEASRL
YEDSGYSSFTQSDRDDGILILENFRNSPQARLLPSQSPDQHPNKTLLPVLHFERVVCSTL
KKNGKRNPKVDREMLKEVIASGNFRLQNIIGKKMGLEHLDILAELSRRGFVHLLANILTK
LSGMDLVNLSKVSRIWKKILENNKGAFQLYSKTMQRVIESSKLSLHATTRGYVVGRAALT
CVQKSSTWAPPKKDVQIKSSSQRGQRVSTYSRHNEFVEVAKTLKNNESLKACVRCNFPAK
YDHYLERAVCKRESCQFEYCTKCLCAYHNNKDCLNGKILKASCKVGPLPGTKKSKKNLQR
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcgcacctgcagtgacctgcgccggccgtcctcctgtccctgccgtcttggc
gcgcggactaccgtggacggttgtaaagaagaaagccctgttctttctgttacaatgaag
tgttttaattgcaaccctgatctttccgagcttgaagtggtgaagcctgaggacagtggg
atagaagcttcctacagtcccgtgtgtttggaaccttcctgtaatgactgtgttagaaac
catgagaggttgtctttcatcgactcaccaattgtgggacatgataacaaggaaaatcaa
cgcgtacaaaacacactagatagttcaaacgaaacagaagagctagaggccagtagactg
tatgaggacagtggctactcatctttcacacaaagtgaccgtgacgatggcatccttatc
ctggagaatttcagaaacagtccccaggcccgtctgctgccatcacagagcccggaccag
catcccaacaaaaccttgctgcctgtcctgcattttgaaagagtggtttgctcaacacta
aaaaagaatggcaagcgaaaccctaaagtggatcgagaaatgctgaaggaagttattgcc
agcgggaactttagactgcaaaatataattggcaagaaaatgggcctggagcacctagac
atcctggctgagctctcccgcaggggattcgtgcacctgttggctaacattttgactaag
ctcagcggcatggacttagtaaatctgtctaaagtgagcagaatttggaagaagatactg
gaaaacaataagggggcgttccagctctacagcaaaaccatgcagcgagtcattgaaagc
agtaagttgtcactacatgctacaacgagaggatatgttgtgggcagagctgcactaact
tgtgttcaaaagtcatcgacctgggcacctcccaaaaaagatgttcaaatcaagtcctcc
agtcagcgtggtcagagagtttctacctacagccggcacaatgagttcgtggaggtggca
aagacattgaagaacaacgaaagcctcaaagcctgtgttcgctgtaatttccctgcaaaa
tatgaccactatttagagcgagcagtctgcaaacgggaaagctgtcaatttgaatattgt
acaaagtgtctgtgtgcttaccataacaacaaagactgtttgaatggcaagatcctaaaa
gccagctgtaaagtgggtcctttgcctggaactaaaaagagtaaaaagaacttacaaaga
ttgtga

DBGET integrated database retrieval system