KEGG   Mus musculus (mouse): 67153
Entry
67153             CDS       T01002                                 

Gene name
Rnaseh2b, 1110019N06Rik, 2610207P08Rik, Dleu, Dleu8
Definition
(RefSeq) ribonuclease H2, subunit B
  KO
K10744  ribonuclease H2 subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    67153 (Rnaseh2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    67153 (Rnaseh2b)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    67153 (Rnaseh2b)
SSDB
Motif
Pfam: RNase_H2-Ydr279 Ydr279_N E2F_CC-MB
Other DBs
NCBI-GeneID: 67153
NCBI-ProteinID: NP_080277
MGI: 1914403
Ensembl: ENSMUSG00000021932
Vega: OTTMUSG00000019771
UniProt: Q80ZV0
Structure
PDB: 
3P5J 3KIO

Position
14; 14 D1
AA seq 308 aa
MAGGRDRGDLAARQLVFLLPEHLKDASKKKKKSSLLFVKLANPHSGEGATYLIDMCLQQL
FEIKVFKEKHHSWFINQSVQSGGLLHFATPMDPLFLLLHYLLKAGKEGKYQPLDQVVVDD
TFPDCTLLLRFPELEKSLRHVTEEKEVNSKKYYKYSSEKTLKWLEKKVNQTVVALKANNV
NVGARVQSSAYFSGGQVSRDKEEDYVRYAHGLISDYIPKELSDDLSKFLKLPEPPASLTN
PPSKKLKLSDEPVEAKEDYTKFNTKDLKTGKKNSKMTAAQKALAKVDKSGMKSIDAFFGA
KNKKTGKI
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccggaggtcgggaccgcggggacttggcggccaggcagctagtgttcctacttcca
gaacatttaaaagatgcctcgaagaagaagaagaagagcagcctcctgttcgtaaagctg
gccaacccgcactcaggggaaggagccacatacttaattgatatgtgtcttcaacagctg
tttgaaataaaagttttcaaggaaaaacaccattcttggtttataaatcaatcagttcaa
tcagggggccttctccactttgccacacccatggatccattgttcctgctccttcactat
ctcctaaaggctggcaaagaggggaagtatcagcccttggaccaagtcgtggtcgatgac
acgtttccagattgcaccttgctgctgagatttcctgagcttgaaaagtcacttcggcat
gtgacagaggaaaaagaagtgaacagcaagaagtactataagtacagctcagagaagaca
ttgaagtggctggagaagaaggtcaaccaaactgtggtggcactaaaagctaataatgtc
aatgttggagcccgggttcagtcatctgcatatttctctggtggtcaggtttccagggac
aaggaagaggattatgttcgctatgcccatggtctgatctctgattacatccctaaagaa
ctgagtgatgatttatccaagttcttgaagcttccagaacctccagcttcattgaccaac
cctccatcaaagaaactaaagttatcagatgagcctgtagaagccaaagaagattacact
aagtttaacactaaagacttgaagaccggcaagaaaaatagcaaaatgactgcagctcag
aaggctttggctaaagttgacaaaagtggaatgaaaagtatcgatgccttttttggtgca
aaaaataaaaaaactggaaagatttga

DBGET integrated database retrieval system