KEGG   Mus musculus (mouse): 67157
Entry
67157             CDS       T01002                                 

Symbol
Cfap418, 2610301B20Rik, AI428449
Name
(RefSeq) cilia and flagella associated protein 418
  KO
K25226  protein C8orf37
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    67157 (Cfap418)
SSDB
Motif
Pfam: RMP
Other DBs
NCBI-GeneID: 67157
NCBI-ProteinID: NP_080281
MGI: 1914407
Ensembl: ENSMUSG00000059482
Vega: OTTMUSG00000009187
UniProt: Q3UJP5
Position
4:10874249..10899425
AA seq 209 aa
MAKDLDELLDEVETKFCRLDPLRLDLGERPKGDGGGGSHSGDRNGAQEKETLRSTETFKK
EDDLDSLINEIFEEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGI
GTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARA
YACQCSWRTVEELTDLQTDHQLRWVCGKH
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgaaggacctggacgaacttctggatgaagtcgagaccaagttctgcagactcgac
cccttgaggctggacctgggtgagcggcccaaaggcgacggcggcggcggctcgcacagc
ggcgaccggaacggagcccaggagaaagaaactctcagatcaacagaaacatttaaaaaa
gaagatgatcttgacagtcttattaatgaaatattcgaggagcctgactttgacagaaaa
tcttttcaaaaatttaaatctaaatcttcaagtaacacatgtgtcagagctcccatgcaa
ggcgtcagtaaaagttgcagtccagtgtatctcagtggaagcgccattccatgtgggatt
ggaacaaatacttcacagagagcatgtgaccgactgcgttgtgtagcctgtgatttccgg
atagtgagctacaatgactatatgtgggacaagtcatgtgactacctgttcttcagaaac
aacatgccagaattccacaaactcaaaacaaaattgatcgagaagaaaggagcacgggca
tatgcctgccagtgtagctggagaactgttgaagaactcactgacctgcagacagatcat
cagcttcgctgggtgtgtggtaaacactga

DBGET integrated database retrieval system