KEGG   Mus musculus (mouse): 67158Help
Entry
67158             CDS       T01002                                 

Gene name
Sft2d3, 2610206C24Rik, AI847965, AW046173
Definition
(RefSeq) SFT2 domain containing 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Got1
Motif
Other DBs
NCBI-GeneID: 67158
NCBI-ProteinID: NP_080282
MGI: 1914408
Ensembl: ENSMUSG00000044982
UniProt: Q9CSV6
Position
18; 18 B1
AA seq 212 aa AA seqDB search
MADLHRQLQDYLKQGKASRPAAAEPLLGAKAAEEPEAGAWLGSRVLRWPWAQSAAEPPPA
GLRCLPSVTRGQRLVAGGLCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSVLAWASA
ALLRGGPACGRLLRGEETPSRSTLGYAAALGATLYAALVLRSTVLTALGACAQVAALLYA
LIGLLPWGGVTALRLALGRLNRGTGLANALPV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctccaccgccagctgcaagactacctgaagcaggggaaagcgagcaggccg
gcggccgcagagccgctgctcggcgcgaaggcagcagaggagcctgaggccggggcctgg
ctaggcagcagggttctgcgatggccgtgggcacagagcgctgccgagccgccacccgcg
ggcttgcgctgcctccccagcgtgacgcgaggccagcgcctggtggcgggcggcctgtgt
ctgctgctggccgcgctctgcttcggcctggcggcgctctacgcgccggtgctgctgctg
cgcgcgcgcaagttcgcgctcctctggtcgctgggctcggtgctggcgtgggcgagcgcg
gcgctgctgcggggcggcccggcgtgcggccgcctgctacgcggcgaggagacgccctcg
cggagcacgcttggctacgccgccgccttgggcgccacgctctacgccgcgctggtcctg
cgcagtacggtgctgacggcgctcggcgcttgcgcacaggtagccgcgctgctctacgcg
ttgatcgggctcctgccctggggcggtgtgacggcgctgcgactggcgctcggtcgccta
aatcgcgggactggcctagccaacgcgctcccggtgtga

DBGET integrated database retrieval system