KEGG   Mus musculus (mouse): 67166Help
Entry
67166             CDS       T01002                                 

Gene name
Arl8b, 2610313E07Rik, 3100002J04Rik, Arl10c, gie1
Definition
(RefSeq) ADP-ribosylation factor-like 8B
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67166 (Arl8b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    67166 (Arl8b)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    67166 (Arl8b)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arl8
    67166 (Arl8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Ras Roc Gtr1_RagA SRPRB G-alpha MMR_HSR1 VirE
Motif
Other DBs
NCBI-GeneID: 67166
NCBI-ProteinID: NP_080287
MGI: 1914416
Ensembl: ENSMUSG00000030105
Vega: OTTMUSG00000056447
UniProt: Q9CQW2
Position
6; 6 E2
AA seq 186 aa AA seqDB search
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKV
TKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL
QGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH
SKSRRS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctcatctcccgcctgctggactggttccgttcgctcttctggaaggaggag
atggaactgacgctcgtggggctgcagtactccggcaagaccaccttcgtcaatgtcatc
gcgtccggtcaattcagtgaagatatgatacccacagtgggcttcaacatgaggaaagta
actaaaggcaacgtcacaataaagatctgggacataggcggacagccccggttccggagc
atgtgggagcggtactgccgaggagtcaatgcaattgtttacatgatagatgctgcagat
cgagaaaagatagaagcctctcgaaatgaactgcataatcttctagataaaccacagtta
caagggattccagtactagtacttggaaacaagagagatcttccaaatgccttggatgag
aaacagctaattgagaaaatgaacctgtctgctattcaggatagagaaatttgctgctat
tcaatttcttgcaaagaaaaggataatatagatatcacacttcagtggcttattcaacac
tcaaaatcccggagaagctga

DBGET integrated database retrieval system