KEGG   Mus musculus (mouse): 67168
Entry
67168             CDS       T01002                                 

Gene name
Lpar6, 2610302I02Rik, P2ry5, P2y5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    67168 (Lpar6)
   04151 PI3K-Akt signaling pathway
    67168 (Lpar6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    67168 (Lpar6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67168 (Lpar6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    67168 (Lpar6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    67168 (Lpar6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 67168
NCBI-ProteinID: NP_780325
MGI: 1914418
Ensembl: ENSMUSG00000033446
Vega: OTTMUSG00000036134
UniProt: Q8BMC0
Position
14; 14 D3
AA seq 344 aa
MVSSNGSQCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCF
CFVPYNINLILYSLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtaagctccaatggctcccagtgcccttatgacgactcctttaagtacactctgtac
gggtgcatgttcagcatggtcttcgtgcttgggctgatatccaactgtgttgcgatatac
attttcatctgtgccctcaaagtgagaaatgaaactacaacgtacatgattaacctggca
atgtcagatttacttttcgtctttactttgccatttcggattttttactttgcaacacgg
aattggccatttggagatctactctgtaagatttcagtaatgctgttttacaccaatatg
tatggaagcattctgttcttaacctgtatcagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactttaagaacgaaacgaaatgcaaagatcgtttgcattgctgtg
tggttcacagtgatgggaggaagtgcgcctgcagttttctttcagtcgacccactctcag
gggaacaatacctcagaagcctgctttgagaactttccagcggccacatggaaaacttat
ctctccaggattgtgattttcattgaaatagtgggcttttttatccctctcattttgaac
gtaacttgttctagtatggtgctaagaactttaaataaacctgttacattaagtagaagc
aaaatgaacaaaactaaggttttaaaaatgatttttgtccacttggtcatcttctgtttc
tgttttgtgccctacaacatcaacctcattttgtactcgctcatgaggacacagaccttt
gttaactgctctgtggtggcggcagtgaggaccatgtacccgatcactctctgcatcgct
gtttccaactgctgctttgaccctattgtttactacttcacctcagacacaattcagaac
tcaataaaaatgaaaaactggtcggttagaagaagtgactccaggttctctgaagttcag
ggcactgagaattttatccaacacaacctacagaccttaaaaaataagatatttgataat
gaatctgcaatataa

DBGET integrated database retrieval system