KEGG   Mus musculus (house mouse): 67177
Entry
67177             CDS       T01002                                 
Symbol
Cdt1, 2610318F11Rik, DUP, Ris2
Name
(RefSeq) chromatin licensing and DNA replication factor 1
  KO
K10727  chromatin licensing and DNA replication factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    67177 (Cdt1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    67177 (Cdt1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    67177 (Cdt1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     67177 (Cdt1)
SSDB
Motif
Pfam: CDT1 CDT1_C
Other DBs
NCBI-GeneID: 67177
NCBI-ProteinID: NP_080290
MGI: 1914427
Ensembl: ENSMUSG00000006585
UniProt: Q8R4E9
Structure
Position
8:123294754..123299869
AA seq 557 aa
MAQSRVTDFYACRRPGLTTPRAKSICLTPSPGGLVAPAFTRSSSRKRARPPAEPGSDQPA
PLARRRLRLPGLDSCPSSLPEPSSPAEPSPPADPSPPADPGSPVCPSPVKRTKSTTVYVG
QQPGKIPSEDSVSELQSCLRRARKLGAQARALRARVQENAVEPSTPDAKVPTEQPCVEKA
PAYQRFHALAQPGLPGLVLPYKYQVLVEMFRSMDTIVSMLHNRSETVTFAKVKQGVQEMM
RKRFEERNVGQIKTVYPTSYRFRQECNVPTFKDSIKRSDYQLTIEPLLGQEAGGATQLTA
TCLLQRRQVFRQNLVERVKEQHKVFLASLNPPMAVPDDQLTRWHPRFNVDEVPDIEPAEL
PQPPVTEKLTTAQEVLARARSLMTPKMEKALSNLALRSAEPGSPGTSTPPLPATPPATPP
AASPSALKGVSQALLERIRAKEVQKQLARMTRCPEQELRLQRLERLPELARVLRNVFVSE
RKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVD
LAGLTARLAHHVHAEGL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcgcaaagtcgtgttaccgatttctatgcgtgccgtcgccctggccttacgactccg
cgggccaagtcgatctgtctcaccccgagccctggtggcctcgtggctcctgcgttcacc
cggagcagcagccgcaagcgcgcccggcccccagccgaacccgggagtgaccagcccgcg
ccgctcgcgcgccggaggttacggctgcctggattggactcctgccccagttctctgcct
gagcccagttccccagctgagcccagccctccagctgaccctagccctccagctgaccct
ggctcccccgtttgcccatcccccgtcaagcgaacaaagagtacaactgtttatgttggt
caacagccgggcaagatcccctcagaggactccgtctctgagctccagtcctgcctgagg
cgggcacggaagttgggagcccaggcacgggccctgagagcccgagtccaagagaatgct
gtggagcctagtaccccagatgccaaggtgcccacagagcaaccatgtgtcgagaaagct
cctgcctaccagcgcttccatgctctggctcagcctggtctcccaggccttgtcctaccc
tacaagtatcaggtgctagttgagatgttccgcagcatggacaccattgtgagcatgctc
cacaatcgctctgagactgtgacctttgccaaagtcaagcaaggtgttcaggagatgatg
cgcaagcgctttgaagagcgcaatgtgggccagatcaaaaccgtgtatcccacgtcgtat
cgcttccgccaggagtgcaatgtccccaccttcaaggacagcatcaagagatctgattac
cagctcaccatcgagcccttgctgggccaggaggctggcggtgccacccagctcacagcc
acgtgcctcctgcagcgccggcaagtcttccggcagaacctggtggaacgtgtcaaggaa
cagcacaaggtcttcctggcttcactgaacccccccatggcggtgccggacgaccagctg
acccgctggcatccgcgcttcaatgtggacgaggtgcctgacattgagccagctgaactg
ccccagcctcctgtcacagagaagctcaccactgcccaggaagtgctggcccgtgcccgg
agcttgatgacacccaagatggagaaggccctgagcaacctggccctgcgctcggctgag
cccggtagccctgggacctctactccaccactcccggccactccgccagccaccccacct
gctgcctctccgagcgccctgaagggtgtgtcccaagcactgctagagcggataagggcc
aaggaggtccagaagcagctggcaaggatgacacggtgccccgagcaggagcttcgcctg
cagcggttagagcgtctgccagagctggcccgcgtgctgcgcaatgtcttcgtgtctgag
cggaagccggcactcactatggaggtggtctgtgcaaggatggtggacagttgccaaact
gctctgagtccaggggagatggagaaacatctggtgctcctggcagagttgctgccggac
tggctcagcctgcatcgcatccgcacggatacctacgtcaagctggacaaggctgttgac
ctggctggcctcactgcgaggctggcccaccacgtccacgccgaggggctgtga

DBGET integrated database retrieval system