KEGG   Mus musculus (house mouse): 67178
Entry
67178             CDS       T01002                                 
Symbol
Zmat5, 2610510L01Rik, D11Bwg0572e, D11Bwg1548e
Name
(RefSeq) zinc finger, matrin type 5
  KO
K13152  U11/U12 small nuclear ribonucleoprotein 20 kDa protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    67178 (Zmat5)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    67178 (Zmat5)
SSDB
Motif
Pfam: zf-CCCH zf-CCCH_4 zf-U1 zf_CCCH_4 zf-CCCH_2
Other DBs
NCBI-GeneID: 67178
NCBI-ProteinID: NP_080291
MGI: 1914428
Ensembl: ENSMUSG00000009076
UniProt: Q9CQR5
Position
11:4654671..4687669
AA seq 170 aa
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSEQDLQELSVQVEEERRAREWPLETAELPEGHLEDWLEKRAKR
LSSAPSSRAEPIRTTVFQYPVGWPPMQELPPSLRAPPPGGWSVLSKVQWG
NT seq 513 nt   +upstreamnt  +downstreamnt
atggggaagcggtacttctgtgactactgtgaccgctccttccaggacaacctccacaac
cgaaagaagcacctgaatggactgcagcacctcaaggccaagaaggtgtggtacgacatg
ttccgagatgcagctgccatcttgctggatgaacagaacaagcggccctgcaggaaattc
ctgctgacaggccagtgcgactttggctccaactgcaggttttcccacatgtcagaacaa
gatctgcaggagctgagcgtccaggtggaagaggagaggcgggccagagaatggccccta
gagaccgccgagcttcctgagggccacctggaggactggctggagaagagagctaagagg
ctaagctcagccccaagtagcagggctgaacccatcagaaccactgtcttccagtatcca
gtgggctggccgccaatgcaggagctgcccccctccctgcgggcacccccacctggaggg
tggtccgtactgtccaaagtccagtggggctga

DBGET integrated database retrieval system