KEGG   Mus musculus (mouse): 67180
Entry
67180             CDS       T01002                                 

Symbol
Yipf5, 2610311I19Rik, AA408236, Yi, Yip1a
Name
(RefSeq) Yip1 domain family, member 5
  KO
K20363  protein YIPF5/7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67180 (Yipf5)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   YIPF proteins
    67180 (Yipf5)
SSDB
Motif
Pfam: Yip1 DUF2374
Other DBs
NCBI-GeneID: 67180
NCBI-ProteinID: NP_075800
MGI: 1914430
Ensembl: ENSMUSG00000024487
UniProt: Q9EQQ2
Position
18; 18 B3
AA seq 257 aa
MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYSQQGRFVPPDMMQPQQ
TYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIWQKTLTVLHPLRAADGS
IMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV
ASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQLLV
AYPCALLYGVFALISVF
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtcaggctttgataacttaaacagcggtttctaccagacgagttacagcatcgacgag
caatctcagcagtcctatgactatggaggaagtggaggaccctacagcaagcagtatgct
ggctgtgactactcgcagcaaggccgatttgtccctccagacatgatgcagccacagcag
acatacactgggcagatttaccagccaactcaggcctatcctccaacaacacctcagcca
ttctatggagacagctttgaggaggagccccctctgttagaagagttgggtatcaatttt
gaccacatttggcaaaaaacactaacggtgctacaccccctgagggcagctgacggcagc
atcatgaatgagacggacttggcagggccagtggtgttctgccttgcctttggggccaca
ctgttactggctggcaaaatccagtttggctacgtatacgggatcagtgcgattggatgt
ttaggaatgttttgtttgttaaatttaatgagtatgacaggtgtgtcatttggctgtgtg
gcaagtgtcctgggctattgtcttcttcccatgatcctgttgtccagctttgcagtggta
ttttctttacaaggaatggtaggaattcttctcactgccacaattattggatggtgtagt
ttttctgcttccaaaatttttatttctgcattagctatggatggacaacaacttttagtg
gcatatccctgtgctttgttgtatggagtctttgccctgatttctgtcttctga

DBGET integrated database retrieval system