KEGG   Mus musculus (house mouse): 67187
Entry
67187             CDS       T01002                                 
Symbol
Zmynd19, 2700064H14Rik, AA536891, AU014915, mizip
Name
(RefSeq) zinc finger, MYND domain containing 19
  KO
K24632  zinc finger MYND domain-containing protein 19
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    67187 (Zmynd19)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   67187 (Zmynd19)
SSDB
Motif
Pfam: zf-MYND HNH_3
Other DBs
NCBI-GeneID: 67187
NCBI-ProteinID: NP_080297
MGI: 1914437
Ensembl: ENSMUSG00000026974
UniProt: Q9CQG3
Position
2:24839789..24850882
AA seq 227 aa
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNR
GRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQR
EQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQ
LREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaccgactttaaattgggcatcgtgcggctcggccgggtggccgggaagaccaaatac
acactgatcgatgagcaagacataccactggtggagagctactcctttgaggctcgaatg
gaagtagatgctgatggaaatggtgctaagatatttgcatatgcctttgacaaaaaccga
ggaaggggctctggcaggcttctacatgagctgctgtgggaacgacacaggggaggtgtg
gctcccgggtttcaggtggtacatctcaatgctgtgactgtggacaatcgcctggacaac
ctgcagctggtaccatggggctggcgacccaaagctgaagagacctccagcaaacaaagg
gagcaaagcttatactggcttgcaatccagcagcttcccacagaccctatagaagaacaa
ttccctgtcttgaatgtgacccggtactataatgccaatggggatgtggtggaagaagaa
gaaaattcctgtacctactatgagtgtcattatcctccttgtacggtgattgaaaagcag
cttcgagagttcaacatctgtgggcgttgccaggtggctcgatactgtggctctcagtgc
cagcagaaggactggcctgcccacaagaagcactgtcgggagaggaagcgtcccttccag
catgagcttgagccagagcgatga

DBGET integrated database retrieval system