KEGG   Mus musculus (mouse): 67204
Entry
67204             CDS       T01002                                 

Gene name
Eif2s2, 2810026E11Rik, 38kDa, AA408636, AA571381, AA986487, AW822225, D2Ertd303e, EIF2, EIF2B
Definition
(RefSeq) eukaryotic translation initiation factor 2, subunit 2 (beta)
  KO
K03238  translation initiation factor 2 subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    67204 (Eif2s2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67204 (Eif2s2)
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    67204 (Eif2s2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     67204 (Eif2s2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    67204 (Eif2s2)
SSDB
Motif
Pfam: eIF-5_eIF-2B Cytochrom_c3_2
Other DBs
NCBI-GeneID: 67204
NCBI-ProteinID: NP_080306
MGI: 1914454
Ensembl: ENSMUSG00000074656
Vega: OTTMUSG00000015977
UniProt: Q99L45 Q3ULL5
Position
2 H1; 2 76.89 cM
AA seq 331 aa
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDAQTEETQPSETKEVEPEPTEEKDVDADEED
SRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEAIKDVKIESDAQEPAEPEDDLDIM
LGNKKKKKKNVKFPEEDEILEKDEALEDEDSKKDDGISFSSQTAWAGSERDYTYEELLNR
VFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLA
ELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQC
ETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtccggggacgagatgatttttgatcctactatgagcaaaaagaaaaagaagaagaag
aagccttttatgttagatgaagaaggtgatgcccagacagaagaaacccagccctcagag
acaaaagaagtggagccagaaccaactgaagaaaaagacgtggacgctgatgaggaagac
agtaggaagaaagatgcttctgatgacttagatgatttgaacttctttaatcaaaagaaa
aagaagaaaaagacaaaaaagatatttgacattgatgaagctgaagaagctataaaggat
gttaagattgagagtgatgctcaagagccagccgagccagaggatgaccttgacattatg
cttggcaacaaaaaaaagaaaaagaagaatgttaaattcccagaagaagatgaaatacta
gaaaaagacgaagctttagaagatgaagacagcaaaaaagatgatggcatttcattcagt
agccaaactgcttgggcaggctcagaaagagactacacatatgaggagttgctgaaccga
gtgttcaacatcatgagagaaaagaatccagatatggttgctggagagaagaggaaattt
gttatgaaacctccacaggtcgtccgagtaggaaccaagaaaacttcttttgtcaatttt
acagatatctgtaaactattacatcgtcaacccaaacatctccttgcatttttattggca
gaattgggtacaagtggttctatagatggtaataaccaacttgtaatcaaaggaagattc
caacagaaacaaatagaaaatgtcttgagaagatatatcaaggaatatgtcacttgtcac
acatgccggtcaccggacacaatcctacagaaggacacccgactctatttcttacaatgt
gaaacttgtcattctcgatgctctgttgccagtatcaaaactggcttccaggctgtcaca
ggcaagcgagcacagctccgtgccaaagctaactaa

DBGET integrated database retrieval system