KEGG   Mus musculus (mouse): 67205
Entry
67205             CDS       T01002                                 

Gene name
Utp11, 2700082D03Rik, CGI-94, Cgi94, Utp11l
Definition
(RefSeq) UTP11 small subunit processome component
  KO
K14769  U3 small nucleolar RNA-associated protein 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    67205 (Utp11)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    67205 (Utp11)
SSDB
Motif
Pfam: Utp11 SLATT_5
Other DBs
NCBI-GeneID: 67205
NCBI-ProteinID: NP_080307
MGI: 1914455
Ensembl: ENSMUSG00000028907
Vega: OTTMUSG00000009171
UniProt: Q9CZJ1
Position
4; 4 D2.2
AA seq 253 aa
MSAAFRKAAKTRQREHRERSQPGFRKRLGLLEKKKDYKLRANDYHKKQDFLRALRKKALE
KNPDEFYYKMTRAKLQDGVHIFKENKEEVTAEQLKLMRTQDIKYIEMKRVAEAKKIERLK
SELHLLDFQGKQQKKHVFFFDTKKEVERFDVATHLQTAPELVDRVYNRPRIETLQKERVK
GATPQTGLKRIAKERQKQYDCLTQRIEREKQLFVVAQKIQTRKDLMDKTQKVKVKKETVN
SPAIYRFQTRRKR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtcggcggcttttcgcaaggcagccaagacccggcagcgggaacaccgagaacgaagc
cagcctggctttcgaaaacgcctgggtttgctggagaaaaagaaagattacaaacttcgt
gcaaatgactatcataaaaaacaagatttcctcagagctctccggaagaaggctcttgaa
aaaaacccagatgaattctactataaaatgactcgggccaagctccaggatggagttcac
attttcaaagagaacaaggaagaagtgacagcagagcagctgaagctcatgagaactcag
gacatcaagtacattgagatgaaaagagttgcagaggcgaagaaaattgaaagattgaaa
tcagagctccatctgctggatttccaggggaagcaacagaagaagcacgtgttctttttt
gacaccaaaaaggaagttgaacggtttgatgttgcaactcacttgcagacggccccagaa
ttagttgacagggtctacaatagaccccggatagagaccttacagaaggagagagtgaaa
ggagccacccctcagactggactcaagcggatagccaaggaacgacagaagcagtatgac
tgtttgacgcagcgcatcgagcgggagaagcagctgttcgttgttgcccagaaaatccag
acacgcaaagacctcatggataaaactcagaaggtgaaggtgaagaaagaaacagtgaac
tccccagctatttacagattccagactcgccgaaaacgttga

DBGET integrated database retrieval system