KEGG   Mus musculus (mouse): 67212
Entry
67212             CDS       T01002                                 

Gene name
Mrpl55, 2810038N09Rik, L55mt, MRP-L55
Definition
(RefSeq) mitochondrial ribosomal protein L55
  KO
K17436  large subunit ribosomal protein L55
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    67212 (Mrpl55)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    67212 (Mrpl55)
SSDB
Motif
Pfam: Mitoc_L55
Other DBs
NCBI-GeneID: 67212
NCBI-ProteinID: NP_001289265
MGI: 1914462
Ensembl: ENSMUSG00000036860
Vega: OTTMUSG00000005787
UniProt: Q9CZ83
Position
11; 11 B1.3
AA seq 127 aa
MPLAILLSLLRHCGVRAALPTPRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDG
STIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQ
FWTKTKK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcctttggccattctgcttagcctgctgaggcattgtggtgtgagagcagccttacct
acaccccgccacctacacacatccccttggagagctgactgcagcagggcttcactcact
cgactgcgccgccaagcctatgctcgcctctaccctgtgctcttggtcaagcaggacggc
tccactatccatatccgataccgggagccacgacgcatgctggcgatgcccctagacctg
gatgccctgtctccagaagagcgcagggcccggttccgaaaacgggaggctcagctccag
cagaagagggaagaagagccagaggtagtggacagttttgacactgaacgatataaacag
ttttggaccaagaccaagaaataa

DBGET integrated database retrieval system