KEGG   Mus musculus (mouse): 67213Help
Entry
67213             CDS       T01002                                 

Gene name
Cmtm6, 2810051A14Rik, AA536733, Cklfsf6
Definition
(RefSeq) CKLF-like MARVEL transmembrane domain containing 6
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL DMT_YdcZ PRIMA1
Motif
Other DBs
NCBI-GeneID: 67213
NCBI-ProteinID: NP_080312
MGI: 2447165
Ensembl: ENSMUSG00000032434
Vega: OTTMUSG00000062858
UniProt: Q9CZ69
Position
9; 9 F3
AA seq 183 aa AA seqDB search
MENGAVYSPTTEAAPGTGRGARSGLAAYFVLGRLPWHRRILKGLQLLLSLLAFICEEVVS
ECGLCGGLYFFEFVSCSAFLLSLLLLIVYCTPVHDRVDTGKVKSSDFYITLGTGCVFLLA
SIIFVSTHSGTSAEIAAIVFGFLASSMFLLDFVVMLCEKLRESPLRKPENNAKVEALTEP
LNA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggagcggtctacagtcccaccaccgaggcggccccgggcactggcaggggt
gcgcgcagcggcctggccgcctacttcgtcctgggcaggctcccttggcatcggcgcatc
ctcaaaggcttgcagctgctgctgtctctcctggccttcatctgtgaagaggttgtgtcc
gagtgtgggttgtgtggaggcctctacttctttgaatttgtgagctgtagcgcctttctc
ctgagcctcctcctgctgatcgtgtactgcaccccagtgcacgacagagtggatactgga
aaagtcaagtcatcggatttttacatcaccctgggaactgggtgtgtgttcctgctggca
tctatcatttttgtctccacccattctgggacctcagctgaaattgctgcaattgtgttt
ggcttcttggcaagctccatgttcctactggacttcgttgtcatgctgtgtgagaagctg
cgggagagcccgctgagaaagcccgagaacaacgcaaaggtggaagccctcaccgaacca
ctgaacgcttaa

DBGET integrated database retrieval system